UniProt UniProt http://www.uniprot.org Specificity of interaction of INI1/hSNF5 with retroviral integrases and its functional significance. Specificity of interaction of INI1/hSNF5 with retroviral integrases and its functional significance. J. Virol. (0022-538X) 2004 imex curation Yung E., Sorin M., Wang E.J., Perumal S., Ott D., Kalpana G.V. Virus - Publications including interactions involving viral proteins HIV-1 integrase has been mapped to the HIV-1 UniProt reference strain. SIV Iintegrase coordinates has been established according alignment with UniProt HIV-1 reference strain. kalpana@aecom.yu.edu Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yung E., Sorin M., Wang E.J., Perumal S., Ott D., Kalpana G.V. Virus - Publications including interactions involving viral proteins HIV-1 integrase has been mapped to the HIV-1 UniProt reference strain. SIV Iintegrase coordinates has been established according alignment with UniProt HIV-1 reference strain. kalpana@aecom.yu.edu Accepted 2015-FEB-23 by ORCHARD J. Virol. (0022-538X) 2004 imex curation Specificity of interaction of INI1/hSNF5 with retroviral integrases and its functional significance. Specificity of interaction of INI1/hSNF5 with retroviral integrases and its functional significance. J. Virol. (0022-538X) 2004 imex curation Yung E., Sorin M., Wang E.J., Perumal S., Ott D., Kalpana G.V. Virus - Publications including interactions involving viral proteins HIV-1 integrase has been mapped to the HIV-1 UniProt reference strain. SIV Iintegrase coordinates has been established according alignment with UniProt HIV-1 reference strain. kalpana@aecom.yu.edu Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Yung E., Sorin M., Wang E.J., Perumal S., Ott D., Kalpana G.V. Virus - Publications including interactions involving viral proteins HIV-1 integrase has been mapped to the HIV-1 UniProt reference strain. SIV Iintegrase coordinates has been established according alignment with UniProt HIV-1 reference strain. kalpana@aecom.yu.edu Accepted 2015-FEB-23 by ORCHARD J. Virol. (0022-538X) 2004 imex curation snf5_human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 SMARCB1 INI1 SNF5L1 Integrase interactor 1 protein BAF47 SNF5 homolog BRG1-associated factor 47 protein protein human Homo sapiens Human MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAPAW B7BCA26875BD943D p04585-pro_0000042447 Integrase gag-pol Pr160Gag-Pol protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 1148 1435 A39EF048DFDDB104 p04584-pro_0000042547 Integrase gag-pol Pr160Gag-Pol protein protein hv2ro Human immunodeficiency virus type 2 subtype A (isolate ROD) (HIV-2) FLEKIEPAQEEHEKYHSNVKELSHKFGIPNLVARQIVNSCAQCQQKGEAIHGQVNAELGTWQMDCTHLEGKIIIVAVHVASGFIEAEVIPQESGRQTALFLLKLASRWPITHLHTDNGANFTSQEVKMVAWWIGIEQSFGVPYNPQSQGVVEAMNHHLKNQISRIREQANTIETIVLMAIHCMNFKRRGGIGDMTPSERLINMITTEQEIQFLQAKNSKLKDFRVYFREGRDQLWKGPGELLWKGEGAVLVKVGTDIKIIPRRKAKIIRDYGGRQEMDSGSHLEGAREDGEMA 1172 1464 3FB6E62D875EDD4C q88016_siv Exoribonuclease H pol Integrase Protease Retropepsin Reverse transcriptase/ribonuclease H protein protein siv Simian immunodeficiency virus VLELWERGTLCKAMQSPKKTGMLEMWKNGPCYGQMPRQTGGFFRPWSMGKEAPQFPHGSSASGADANCSPRGPSCGSAKELHAVGQAAERKAERKQREALQGGDRGFAAPQFSLWRRPVVTAHIEGQPVEVLLDTGADDSIVTGIELGPHYTPKIVGGIGGFINTKEYKNVEIEVLGKRIKGTIMTGDTPINIFGRNLLTALGMSLNFPIAKVEPVKVALKPGKDGPKLKQWPLSKEKIVALREICEKMEKDGQLEEAPPTNPYNTPTFAIKKKDKNKWRMLIDFRELNRVTQDFTEVQLGIPHPAGLAKRKRITVLDIGDAYFSIPLDEEFRQYTAFTLPSVNNAEPGKRYIYKVLPQGWKGSPAIFQYTMRHVLEPFRKANPDVTLVQYMDDILIASDRTDLEHDRVVLQSKELLNSIGFSTPEEKFQKDPPFQWMGYELWPTKWKLQKIELPQRETWTVNDIQKLVGVLNWAAQIYPGIKTKHLCRLIRGKMTLTEEVQWTEMAEAEYEENKIILSQEQEGCYYQEGKPLEATVIKSQDNQWSYKIHQEDKILKVGKFAKIKNTHTNGVRLLAHVIQKIGKEAIVIWGQVPKFHLPVEKDVWEQWWTDYWQVTWIPEWDFISTPPLVRLVFNLVKDPIEGEETYYTDGSCNKQSKEGKAGYITDRGKDKVKVLEQTTNQQAELEAFLMALTDSGPKANIIVDSQYVMGIITGCPTESESRLVNQIIEEMIKKSEIYVAWVPAHKGIGGNQEIDHLVSQGIRQVLFLEKIEPAQEEHDKYHSNVKELVFKFGLPRIVARQIVDTCDKCHQKGEAIHGQANSDLGTWQMDCTHLEGKIIIVAVHVASGFIEAEVIPQETGRQTALFLLKLAGRWPITHLHTDNGANFASQEVKMVAWWAGIEHTFGVPYNPQSQGVVEAMNHHLKNQIDRIREQANSVETIVLMAVHCMNFKRRGGIGDMTPAERLINMITTEQEIQFQQSKNSKFKNFRVYYREGRDQLWKGPGELLWKGEGAVILKVGTDIKVVPRRKAKIIKDYGGGKEVDSSSHMEDTGEAREVA 0A1265BBD12C3483 smarcb1-gag_pol 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association table 3 gag_pol-smarcb1 1 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association table 3 gag_pol-smarcb1-1 2 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 3 gag_pol-smarcb1-2 1 3 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association table 3 weak interaction, not observed when swapping bait/prey pol-smarcb1 1 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role prey prey physical association physical association table 3 weak interaction, not observed when swapping bait/prey