UniProt UniProt http://www.uniprot.org Mechanistic studies of human molybdopterin synthase reaction and characterization of mutants identified in group B patients of molybdenum cofactor deficiency. Mechanistic studies of human molybdopterin synthase reaction and characterization of mutants identified in group B patients of molybdenum cofactor deficiency. J. Biol. Chem. (0021-9258) 2003 imex curation Leimkuhler S., Freuer A., Araujo J.A., Rajagopalan K.V., Mendel R.R. s.leimkuehler@tu-bs.de 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Leimkuhler S., Freuer A., Araujo J.A., Rajagopalan K.V., Mendel R.R. s.leimkuehler@tu-bs.de Accepted 2015-JAN-28 by MGT J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation moc2a_human Molybdopterin synthase sulfur carrier subunit MOCS2 MOCO1 MOCO1-A Molybdenum cofactor synthesis protein 2 small subunit Molybdenum cofactor synthesis protein 2A Molybdopterin-synthase small subunit Sulfur carrier protein MOCS2A protein protein human Homo sapiens Human MVPLCQVEVLYFAKSAEITGVRSETISVPQEIKALQLWKEIETRHPGLADVRNQIIFAVRQEYVELGDQLLVLQPGDEIAVIPPISGG BD08B374B615E7BE moc2b_human Molybdopterin synthase catalytic subunit Molybdenum cofactor synthesis protein 2 large subunit Molybdopterin-synthase large subunit Molybdenum cofactor synthesis protein 2B MOCO1-B MOCS2 MCBPE MOCO1 protein protein human Homo sapiens Human MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNKECFWASNS F405256D85621146 mocs2-mocs2-2 1 2 unspecified role unspecified role neutral component neutral component purified purified O96033:p.Val7Phe mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain V F Variant found in Molybdenum cofactor deficiency, complementation group B (MOCODB) [MIM:252160]; UniProt FTId: VAR_054854 Wed May 02 17:52:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val7phe' Tue Jun 30 15:38:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val7Phe' ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 2, 6A Whereas the the MOCS2A-V7F variant did not form a complex with MOCS2B; the MPT synthase tetramer was readily formed in mixtures of MOCS2B-E168K and equimolar amounts of MOCS2A. mocs2-mocs2-3 1 2 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 2 Elution position is suggesting homodimer formation in solution mocs2-mocs2-4 1 3 unspecified role unspecified role neutral component neutral component purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 2 Elution position is suggesting homodimer formation in solution