UniProt UniProt http://www.uniprot.org The adeno-associated virus type 2 regulatory proteins rep78 and rep68 interact with the transcriptional coactivator PC4. The adeno-associated virus type 2 regulatory proteins rep78 and rep68 interact with the transcriptional coactivator PC4. J. Virol. (0022-538X) 1999 imex curation Weger S., Wendland M., Kleinschmidt J.A., Heilbronn R. Viral proteins have beem mapped to the UniProt adeno-associated virus 2 reference proteome strain heilbronn@ukbf.fu-berlin.de 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Weger S., Wendland M., Kleinschmidt J.A., Heilbronn R. Viral proteins have beem mapped to the UniProt adeno-associated virus 2 reference proteome strain heilbronn@ukbf.fu-berlin.de Accepted 2014-MAY-06 by ORCHARD HeLa cDNA J. Virol. (0022-538X) 1999 imex curation The adeno-associated virus type 2 regulatory proteins rep78 and rep68 interact with the transcriptional coactivator PC4. The adeno-associated virus type 2 regulatory proteins rep78 and rep68 interact with the transcriptional coactivator PC4. J. Virol. (0022-538X) 1999 imex curation Weger S., Wendland M., Kleinschmidt J.A., Heilbronn R. Viral proteins have beem mapped to the UniProt adeno-associated virus 2 reference proteome strain heilbronn@ukbf.fu-berlin.de 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Weger S., Wendland M., Kleinschmidt J.A., Heilbronn R. Viral proteins have beem mapped to the UniProt adeno-associated virus 2 reference proteome strain heilbronn@ukbf.fu-berlin.de Accepted 2014-MAY-06 by ORCHARD J. Virol. (0022-538X) 1999 imex curation The adeno-associated virus type 2 regulatory proteins rep78 and rep68 interact with the transcriptional coactivator PC4. The adeno-associated virus type 2 regulatory proteins rep78 and rep68 interact with the transcriptional coactivator PC4. J. Virol. (0022-538X) 1999 imex curation Weger S., Wendland M., Kleinschmidt J.A., Heilbronn R. Viral proteins have beem mapped to the UniProt adeno-associated virus 2 reference proteome strain heilbronn@ukbf.fu-berlin.de 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Weger S., Wendland M., Kleinschmidt J.A., Heilbronn R. Viral proteins have beem mapped to the UniProt adeno-associated virus 2 reference proteome strain heilbronn@ukbf.fu-berlin.de Accepted 2014-MAY-06 by ORCHARD J. Virol. (0022-538X) 1999 imex curation The adeno-associated virus type 2 regulatory proteins rep78 and rep68 interact with the transcriptional coactivator PC4. The adeno-associated virus type 2 regulatory proteins rep78 and rep68 interact with the transcriptional coactivator PC4. J. Virol. (0022-538X) 1999 imex curation Weger S., Wendland M., Kleinschmidt J.A., Heilbronn R. Viral proteins have beem mapped to the UniProt adeno-associated virus 2 reference proteome strain heilbronn@ukbf.fu-berlin.de 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Weger S., Wendland M., Kleinschmidt J.A., Heilbronn R. Viral proteins have beem mapped to the UniProt adeno-associated virus 2 reference proteome strain heilbronn@ukbf.fu-berlin.de Accepted 2014-MAY-06 by ORCHARD J. Virol. (0022-538X) 1999 imex curation rep68_aav2s Protein Rep68 Rep68 protein protein aav-2 Adeno-associated virus 2 (isolate Srivastava/1982) AAV-2 MPGFYEIVIKVPSDLDGHLPGISDSFVNWVAEKEWELPPDSDMDLNLIEQAPLTVAEKLQRDFLTEWRRVSKAPEALFFVQFEKGESYFHMHVLVETTGVKSMVLGRFLSQIREKLIQRIYRGIEPTLPNWFAVTKTRNGAGGGNKVVDECYIPNYLLPKTQPELQWAWTNMEQYLSACLNLTERKRLVAQHLTHVSQTQEQNKENQNPNSDAPVIRSKTSARYMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGGAKKRPAPSDADISEPKRVRESVAQPSTSDAEASINYADRLARGHSL Essential for DNA replication mint 7C1ECDD4E07703C8 rep78_aav2s Protein Rep78 Rep78 protein protein aav-2 Adeno-associated virus 2 (isolate Srivastava/1982) AAV-2 MPGFYEIVIKVPSDLDGHLPGISDSFVNWVAEKEWELPPDSDMDLNLIEQAPLTVAEKLQRDFLTEWRRVSKAPEALFFVQFEKGESYFHMHVLVETTGVKSMVLGRFLSQIREKLIQRIYRGIEPTLPNWFAVTKTRNGAGGGNKVVDECYIPNYLLPKTQPELQWAWTNMEQYLSACLNLTERKRLVAQHLTHVSQTQEQNKENQNPNSDAPVIRSKTSARYMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGGAKKRPAPSDADISEPKRVRESVAQPSTSDAEASINYADRYQNKCSRHVGMNLMLFPCRQCERMNQNSNICFTHGQKDCLECFPVSESQPVSVVKKAYQKLCYIHHIMGKVPDACTACDLVNVDLDDCIFEQ FBF4F1FEAF48FF2A tcp4_human Activated RNA polymerase II transcriptional coactivator p15 SUB1 homolog Positive cofactor 4 p14 SUB1 PC4 RPO2TC1 protein protein human Homo sapiens Human MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL DIP protein P53999 original sequence version: 60 0DAE0CAAAD5E4E15 rep40_aav2s Protein Rep40 Rep40 protein protein aav-2 Adeno-associated virus 2 (isolate Srivastava/1982) AAV-2 MELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGGAKKRPAPSDADISEPKRVRESVAQPSTSDAEASINYADRLARGHSL 9465A291F2B044F0 rep-sub1 1 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association no figure rep-sub1-1 3 7 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain P03132:p.Lys340His mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K H Wed May 02 14:27:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys340his' Tue Jun 30 20:02:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys340His' physical association physical association 3 and 4 sub1-q89268 4 7 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association 5 rep-sub1-3 2 7 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 30 27 direct interaction direct interaction 6B and C SUB1/PC4 phosphorylated (by addition of CKII) and nonphosphorylated form showed interaction. Rep68 mutation lys340his did not change the interaction. q89269-sub1 2 7 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 6B