bhf-ucl Smad6 inhibits BMP/Smad1 signaling by specifically competing with the Smad4 tumor suppressor. Smad6 inhibits BMP/Smad1 signaling by specifically competing with the Smad4 tumor suppressor. Genes Dev. (0890-9369) 1998 imex curation Hata A., Lagna G., Massagué J., Hemmati-Brivanlou A. Cardiac - Interactions involving cardiac related proteins Flag-Smad1 and pGAL4-Smad 1 constructs are found in Liu et al. 1996 (PMID: 8637600) HA-Samd4 construct is found in Hata et al. 1997 (PMID:9214507) Figs. 4A, 7A not annotated because the authors don't provide the species origin of the HA-tagged receptors j-massague@ski.mskcc.org brvnlou@rockvax.rockefeller.edu 12-Nov-2014: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos Chlorocebus aethiops cos cos anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hata A., Lagna G., Massagué J., Hemmati-Brivanlou A. Cardiac - Interactions involving cardiac related proteins Flag-Smad1 and pGAL4-Smad 1 constructs are found in Liu et al. 1996 (PMID: 8637600) HA-Samd4 construct is found in Hata et al. 1997 (PMID:9214507) j-massague@ski.mskcc.org brvnlou@rockvax.rockefeller.edu Accepted 2014-NOV-07 by MGT Genes Dev. (0890-9369) 1998 imex curation Smad6 inhibits BMP/Smad1 signaling by specifically competing with the Smad4 tumor suppressor. Smad6 inhibits BMP/Smad1 signaling by specifically competing with the Smad4 tumor suppressor. Genes Dev. (0890-9369) 1998 imex curation Hata A., Lagna G., Massagué J., Hemmati-Brivanlou A. Cardiac - Interactions involving cardiac related proteins Flag-Smad1 and pGAL4-Smad 1 constructs are found in Liu et al. 1996 (PMID: 8637600) HA-Samd4 construct is found in Hata et al. 1997 (PMID:9214507) Figs. 4A, 7A not annotated because the authors don't provide the species origin of the HA-tagged receptors j-massague@ski.mskcc.org brvnlou@rockvax.rockefeller.edu 12-Nov-2014: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hata A., Lagna G., Massagué J., Hemmati-Brivanlou A. Cardiac - Interactions involving cardiac related proteins Flag-Smad1 and pGAL4-Smad 1 constructs are found in Liu et al. 1996 (PMID: 8637600) HA-Samd4 construct is found in Hata et al. 1997 (PMID:9214507) j-massague@ski.mskcc.org brvnlou@rockvax.rockefeller.edu Accepted 2014-NOV-07 by MGT Genes Dev. (0890-9369) 1998 imex curation smad1_human Mothers against decapentaplegic homolog 1 Mad-related protein 1 SMAD family member 1 Transforming growth factor-beta-signaling protein 1 JV4-1 SMAD1 BSP1 MADH1 MADR1 protein protein human Homo sapiens Human MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS DIP protein Q15797 original sequence version: 167 DIP protein Q15797 original sequence version: 145 DIP protein Q15797 original sequence version: 133 2DD34B7F434DBC7E smad6_human Mothers against decapentaplegic homolog 6 SMAD family member 6 SMAD6 MADH6 protein protein human Homo sapiens Human MFRSKRSGLVRRLWRSRVVPDREEGGSGGGGGGDEDGSLGSRAEPAPRAREGGGCGRSEVRPVAPRRPRDAVGQRGAQGAGRRRRAGGPPRPMSEPGAGAGSSLLDVAEPGGPGWLPESDCETVTCCLFSERDAAGAPRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLLKRLKERSLDTLLEAVESRGGVPGGCVLVPRADLRLGGQPAPPQLLLGRLFRWPDLQHAVELKPLCGCHSFAAAADGPTVCCNPYHFSRLCGPESPPPPYSRLSPRDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTRSKIGFGILLSKEPDGVWAYNRGEHPIFVNSPTLDAPGGRALVVRKVPPGYSIKVFDFERSGLQHAPEPDAADGPYDPNSVRISFAKGWGPCYSRQFITSCPCWLEILLNNPR DIP protein O43541 original sequence version: 127 A4B928AE2D34EBC2 smad4_human Mothers against decapentaplegic homolog 4 SMAD4 DPC4 MADH4 SMAD family member 4 Deletion target in pancreatic carcinoma 4 protein protein human Homo sapiens Human MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQIASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGHYWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD DIP protein Q13485 original sequence version: 149 DIP protein Q13485 original sequence version: 177 7EE3C4647712DA90 smad6-smad6-4 1 4 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig.5A The Smad 6 association with itself is independent of the BMP2 and TGF beta treatments. smad1-smad6 1 3 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig.5A, 6B The interaction between full length Smad6 and full length Smad1 is dependent on BMP stimulation. The interaction between the c-terminal fragment of Smad6 and full length Smad1 is BMP and TGFbeta independent and increases with BMP but not with TGF beta treatment. BMP2 smad6-smad6-6 2 4 unspecified role unspecified role bait bait c-terminal domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey c-terminal domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 5B smad6-smad1-1 2 3 unspecified role unspecified role prey prey c-terminal domain sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait c-terminal domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 5B smad1-smad4-3 1 5 unspecified role unspecified role prey prey c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 3 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 6A BMP2 Interaction between Smad1 and Smad4 is BMP2 dependent Smad6 smad1-smad4-4 1 5 competitor competitor competitor prey prey c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Fig. 6B BMP2 Interaction between Smad1 and Smad4 is BMP2 dependent COS cells were transfected with increasing amounts of Smad4 smad6-smad1-2 1 3 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range O43541:p.Gly471Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G S Wed May 02 14:49:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly471ser' Tue Jun 30 16:45:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly471Ser' c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig.7B The interaction between full length Smad6 and full length Smad1 is dependent on BMP stimulation. BMP2