IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Naturally Occurring Neomorphic PIK3R1 Mutations Activate the MAPK Pathway, Dictating Therapeutic Response to MAPK Pathway Inhibitors. Naturally Occurring Neomorphic PIK3R1 Mutations Activate the MAPK Pathway, Dictating Therapeutic Response to MAPK Pathway Inhibitors. Cancer Cell (1535-6108) 2014 imex curation Cheung L.W., Yu S., Zhang D., Li J., Ng P.K., Panupinthu N., Mitra S., Ju Z., Yu Q., Liang H., Hawke D.H., Lu Y., Broaddus R.R., Mills G.B. Cancer - Interactions investigated in the context of cancer It is not explicitly stated either here or in the earlier publication (2011) that HA-p85a is Human in origin but I cannot think it would be anything else...if you want I will write to the authors to confirm... wcheung@mdanderson.org,gmills@mdanderson.org 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-skut2 Human-SK-UT-2 skut2 SK-UT-2 human endometrial grade 3 carcinoma derived cell line No info can be found on this cell line - probably a derivative of SK-UT1 or SK-UT-1B. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cheung L.W., Yu S., Zhang D., Li J., Ng P.K., Panupinthu N., Mitra S., Ju Z., Yu Q., Liang H., Hawke D.H., Lu Y., Broaddus R.R., Mills G.B. Cancer - Interactions investigated in the context of cancer It is not explicitly stated either here or in the earlier publication (2011) that HA-p85a is Human in origin but I cannot think it would be anything else...if you want I will write to the authors to confirm... wcheung@mdanderson.org wcheung@mdanderson.org,gmills@mdanderson.org Accepted 2015-JAN-21 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Naturally Occurring Neomorphic PIK3R1 Mutations Activate the MAPK Pathway, Dictating Therapeutic Response to MAPK Pathway Inhibitors. Naturally Occurring Neomorphic PIK3R1 Mutations Activate the MAPK Pathway, Dictating Therapeutic Response to MAPK Pathway Inhibitors. Cancer Cell (1535-6108) 2014 imex curation Cheung L.W., Yu S., Zhang D., Li J., Ng P.K., Panupinthu N., Mitra S., Ju Z., Yu Q., Liang H., Hawke D.H., Lu Y., Broaddus R.R., Mills G.B. Cancer - Interactions investigated in the context of cancer It is not explicitly stated either here or in the earlier publication (2011) that HA-p85a is Human in origin but I cannot think it would be anything else...if you want I will write to the authors to confirm... wcheung@mdanderson.org,gmills@mdanderson.org 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-ovk18 Human-OVK18 ovarian endometrioid carcinoma ovk18 OVK18 ovarian endometrioid carcinoma no reference found, but this cell line is listed the Riken Bioresource Centre. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cheung L.W., Yu S., Zhang D., Li J., Ng P.K., Panupinthu N., Mitra S., Ju Z., Yu Q., Liang H., Hawke D.H., Lu Y., Broaddus R.R., Mills G.B. Cancer - Interactions investigated in the context of cancer It is not explicitly stated either here or in the earlier publication (2011) that HA-p85a is Human in origin but I cannot think it would be anything else...if you want I will write to the authors to confirm... PIK3R1 L370fs mutant is a truncation mutant; as confirmed by Editors choice article -Morphin’ Mutant p85α Ref: Sci. Signal., 28 October 2014, Ferrarelli. L. wcheung@mdanderson.org wcheung@mdanderson.org,gmills@mdanderson.org Accepted 2015-JAN-21 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Naturally Occurring Neomorphic PIK3R1 Mutations Activate the MAPK Pathway, Dictating Therapeutic Response to MAPK Pathway Inhibitors. Naturally Occurring Neomorphic PIK3R1 Mutations Activate the MAPK Pathway, Dictating Therapeutic Response to MAPK Pathway Inhibitors. Cancer Cell (1535-6108) 2014 imex curation Cheung L.W., Yu S., Zhang D., Li J., Ng P.K., Panupinthu N., Mitra S., Ju Z., Yu Q., Liang H., Hawke D.H., Lu Y., Broaddus R.R., Mills G.B. Cancer - Interactions investigated in the context of cancer It is not explicitly stated either here or in the earlier publication (2011) that HA-p85a is Human in origin but I cannot think it would be anything else...if you want I will write to the authors to confirm... wcheung@mdanderson.org,gmills@mdanderson.org 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-skut2 Human-SK-UT-2 skut2 SK-UT-2 human endometrial grade 3 carcinoma derived cell line No info can be found on this cell line - probably a derivative of SK-UT1 or SK-UT-1B. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cheung L.W., Yu S., Zhang D., Li J., Ng P.K., Panupinthu N., Mitra S., Ju Z., Yu Q., Liang H., Hawke D.H., Lu Y., Broaddus R.R., Mills G.B. Cancer - Interactions investigated in the context of cancer It is not explicitly stated either here or in the earlier publication (2011) that HA-p85a is Human in origin but I cannot think it would be anything else...if you want I will write to the authors to confirm... wcheung@mdanderson.org wcheung@mdanderson.org,gmills@mdanderson.org Accepted 2015-JAN-21 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Naturally Occurring Neomorphic PIK3R1 Mutations Activate the MAPK Pathway, Dictating Therapeutic Response to MAPK Pathway Inhibitors. Naturally Occurring Neomorphic PIK3R1 Mutations Activate the MAPK Pathway, Dictating Therapeutic Response to MAPK Pathway Inhibitors. Cancer Cell (1535-6108) 2014 imex curation Cheung L.W., Yu S., Zhang D., Li J., Ng P.K., Panupinthu N., Mitra S., Ju Z., Yu Q., Liang H., Hawke D.H., Lu Y., Broaddus R.R., Mills G.B. Cancer - Interactions investigated in the context of cancer It is not explicitly stated either here or in the earlier publication (2011) that HA-p85a is Human in origin but I cannot think it would be anything else...if you want I will write to the authors to confirm... wcheung@mdanderson.org,gmills@mdanderson.org 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-skut2 Human-SK-UT-2 skut2 SK-UT-2 human endometrial grade 3 carcinoma derived cell line No info can be found on this cell line - probably a derivative of SK-UT1 or SK-UT-1B. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cheung L.W., Yu S., Zhang D., Li J., Ng P.K., Panupinthu N., Mitra S., Ju Z., Yu Q., Liang H., Hawke D.H., Lu Y., Broaddus R.R., Mills G.B. Cancer - Interactions investigated in the context of cancer It is not explicitly stated either here or in the earlier publication (2011) that HA-p85a is Human in origin but I cannot think it would be anything else...if you want I will write to the authors to confirm... Samples were fractionated using a gel filtration column prior to IP. SKUT2 cells were transfected with HA-tagged NES-PIK3R1R348∗ wcheung@mdanderson.org,gmills@mdanderson.org wcheung@mdanderson.org Accepted 2015-JAN-21 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Naturally Occurring Neomorphic PIK3R1 Mutations Activate the MAPK Pathway, Dictating Therapeutic Response to MAPK Pathway Inhibitors. Naturally Occurring Neomorphic PIK3R1 Mutations Activate the MAPK Pathway, Dictating Therapeutic Response to MAPK Pathway Inhibitors. Cancer Cell (1535-6108) 2014 imex curation Cheung L.W., Yu S., Zhang D., Li J., Ng P.K., Panupinthu N., Mitra S., Ju Z., Yu Q., Liang H., Hawke D.H., Lu Y., Broaddus R.R., Mills G.B. Cancer - Interactions investigated in the context of cancer It is not explicitly stated either here or in the earlier publication (2011) that HA-p85a is Human in origin but I cannot think it would be anything else...if you want I will write to the authors to confirm... wcheung@mdanderson.org,gmills@mdanderson.org 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-skut2 Human-SK-UT-2 skut2 SK-UT-2 human endometrial grade 3 carcinoma derived cell line No info can be found on this cell line - probably a derivative of SK-UT1 or SK-UT-1B. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cheung L.W., Yu S., Zhang D., Li J., Ng P.K., Panupinthu N., Mitra S., Ju Z., Yu Q., Liang H., Hawke D.H., Lu Y., Broaddus R.R., Mills G.B. Cancer - Interactions investigated in the context of cancer It is not explicitly stated either here or in the earlier publication (2011) that HA-p85a is Human in origin but I cannot think it would be anything else...if you want I will write to the authors to confirm... Samples were fractionated using a gel filtration column prior to IP. wcheung@mdanderson.org,gmills@mdanderson.org wcheung@mdanderson.org Accepted 2015-JAN-21 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation rac1_human Ras-related C3 botulinum toxin substrate 1 RAC1 MIG5 p21-Rac1 Ras-like protein TC25 Cell migration-inducing gene 5 protein TC25 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL ACEDF83A45E5EA67 p85a_human Phosphatidylinositol 3-kinase regulatory subunit alpha PIK3R1 GRB1 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha protein protein human Homo sapiens Human MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADVEQQALTLPDLAEQFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDTPSVDLEMIDVHVLADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNERQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR DIP protein P27986 original sequence version: 181 DIP protein P27986 original sequence version: 184 DIP protein P27986-1 original sequence version: 135 DIP protein P27986 original sequence version: 135 DIP protein P27986-1 original sequence version: 145 DIP protein P27986-1 original sequence version: 147 DIP protein P27986 original sequence version: 191 B9DAD8416C33140F mk08_human Mitogen-activated protein kinase 8 MAPK8 JNK1 PRKM8 Stress-activated protein kinase JNK1 c-Jun N-terminal kinase 1 JNK-46 SAPK1 Stress-activated protein kinase 1c SAPK1C protein protein human Homo sapiens Human MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAAGPLGCCR DIP protein P45983 original sequence version: 96 DIP protein P45983 original sequence version: 185 DIP protein P45983 original sequence version: 124 DIP protein P45983 original sequence version: 103 94FB6BE0358B9B60 mk09_human Mitogen-activated protein kinase 9 Stress-activated protein kinase JNK2 c-Jun N-terminal kinase 2 JNK-55 MAPK9 JNK2 PRKM9 Stress-activated protein kinase 1a SAPK1A protein protein human Homo sapiens Human MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIHMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQLGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSKMLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEVMDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPLEGCR 9C15DA79981290AF cdc42_human Cell division control protein 42 homolog CDC42 G25K GTP-binding protein protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL 51A437E22A4D8FFF mp2k7_human Dual specificity mitogen-activated protein kinase kinase 7 MAPK/ERK kinase 7 JNK-activating kinase 2 c-Jun N-terminal kinase kinase 2 MAP2K7 JNKK2 MKK7 PRKMK7 MEK7 Stress-activated protein kinase kinase 4 SKK4 protein protein human Homo sapiens Human MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSESSPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQPHLPFFR F1B22E050F54299A m3k11_human Mitogen-activated protein kinase kinase kinase 11 MAP3K11 Mixed lineage kinase 3 Src-homology 3 domain-containing proline-rich kinase SPRK PTK1 MLK3 protein protein human Homo sapiens Human MEPLKSLFLKSPLGSWNGSGSGGGGGGGGGRPEGSPKAAGYANPVWTALFDYEPSGQDELALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGPPPCEVASFQELRLEEVIGIGGFGKVYRGSWRGELVAVKAARQDPDEDISVTAESVRQEARLFAMLAHPNIIALKAVCLEEPNLCLVMEYAAGGPLSRALAGRRVPPHVLVNWAVQIARGMHYLHCEALVPVIHRDLKSNNILLLQPIESDDMEHKTLKITDFGLAREWHKTTQMSAAGTYAWMAPEVIKASTFSKGSDVWSFGVLLWELLTGEVPYRGIDCLAVAYGVAVNKLTLPIPSTCPEPFAQLMADCWAQDPHRRPDFASILQQLEALEAQVLREMPRDSFHSMQEGWKREIQGLFDELRAKEKELLSREEELTRAAREQRSQAEQLRRREHLLAQWELEVFERELTLLLQQVDRERPHVRRRRGTFKRSKLRARDGGERISMPLDFKHRITVQASPGLDRRRNVFEVGPGDSPTFPRFRAIQLEPAEPGQAWGRQSPRRLEDSSNGERRACWAWGPSSPKPGEAQNGRRRSRMDEATWYLDSDDSSPLGSPSTPPALNGNPPRPSLEPEEPKRPVPAERGSSSGTPKLIQRALLRGTALLASLGLGRDLQPPGGPGRERGESPTTPPTPTPAPCPTEPPPSPLICFSLKTPDSPPTPAPLLLDLGIPVGQRSAKSPRREEEPRGGTVSPPPGTSRSAPGTPGTPRSPPLGLISRPRPSPLRSRIDPWSFVSAGPRPSPLPSPQPAPRRAPWTLFPDSDPFWDSPPANPFQGGPQDCRAQTKDMGAQAPWVPEAGP AFB6E930EA281C15 pik3r1-cdc42-5 1 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5A pik3r1-cdc42-9 1 12 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6A The presence of WT p85a or a nuclear export signal fused to the N-terminus of the p85a R348* mutant reduced nuclear complex formation, but not cytosolic complex formation. mapk8-pik3r1-1 3 8 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey association association 6B The presence of WT p85a or a nuclear export signal fused to the N-terminus of the p85a R348* mutant reduced the number of interactors in this nuclear complex. pik3r1-cdc42-13 2 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association Supp 6A pik3r1-cdc42-12 5 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey association association Supp 6C/E pik3r1-cdc42-12 5 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey association association 6D fractions 25-29, 6E Supp 6 D/E The presence of WT p85a or a nuclear export signal fused to the N-terminus of the p85a R348* mutant reduced nuclear complex formation, but not cytosolic complex formation. Supp fig 6C; this interaction was only detected in lane 29. mapk8-cdc42 3 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey association association 6B The presence of WT p85a or a nuclear export signal fused to the N-terminus of the p85a R348* mutant reduced the number of interactors in this nuclear complex. WT p85a. A nuclear export signal fused to the N-terminus of the p85a R348* mutant. mapk8-pik3r1-3 4 8 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey association association 6F