MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Structure and mechanism of the primosome protein DnaT: functional structures for homotrimerization, dissociation of ssDNA from PriB-ssDNA complex and formation of DnaT-ssDNA complex. Structure and mechanism of the primosome protein DnaT: functional structures for homotrimerization, dissociation of ssDNA from PriB-ssDNA complex and formation of DnaT-ssDNA complex. FEBS J. (1742-464X) 2014 imex curation Fujiyama S., Abe Y., Tani J., Urabe M., Sato K., Aramaki T., Katayama T., Ueda T. ueda@phar.kyushu-u.ac.jp 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined ueda@phar.kyushu-u.ac.jp Accepted 2014-SEP-26 by LUANA 2014 imex curation Structure and mechanism of the primosome protein DnaT: functional structures for homotrimerization, dissociation of ssDNA from PriB-ssDNA complex and formation of DnaT-ssDNA complex. Structure and mechanism of the primosome protein DnaT: functional structures for homotrimerization, dissociation of ssDNA from PriB-ssDNA complex and formation of DnaT-ssDNA complex. FEBS J. (1742-464X) 2014 imex curation Fujiyama S., Abe Y., Tani J., Urabe M., Sato K., Aramaki T., Katayama T., Ueda T. ueda@phar.kyushu-u.ac.jp 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined ueda@phar.kyushu-u.ac.jp Accepted 2014-SEP-26 by LUANA 2014 imex curation Structure and mechanism of the primosome protein DnaT: functional structures for homotrimerization, dissociation of ssDNA from PriB-ssDNA complex and formation of DnaT-ssDNA complex. Structure and mechanism of the primosome protein DnaT: functional structures for homotrimerization, dissociation of ssDNA from PriB-ssDNA complex and formation of DnaT-ssDNA complex. FEBS J. (1742-464X) 2014 imex curation Fujiyama S., Abe Y., Tani J., Urabe M., Sato K., Aramaki T., Katayama T., Ueda T. ueda@phar.kyushu-u.ac.jp 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined ueda@phar.kyushu-u.ac.jp Accepted 2014-SEP-26 by LUANA 2014 imex curation dnat_ecoli Primosomal protein 1 dnaT b4362 JW4326 Primosomal protein I protein protein ecoli Escherichia coli (strain K12) MSSRVLTPDVVGIDALVHDHQTVLAKAEGGVVAVFANNAPAFYAVTPARLAELLALEEKLARPGSDVALDDQLYQEPQAAPVAVPMGKFAMYPDWQPDADFIRLAALWGVALREPVTTEELASFIAYWQAEGKVFHHVQWQQKLARSLQIGRASNGGLPKRDVNTVSEPDSQIPPGFRG 8DE048A3B2A6235B 8DE048A3B2A6235B prib_ecoli Primosomal replication protein N priB b4201 JW4159 protein protein ecoli Escherichia coli (strain K12) MTNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSGD DIP protein P07013 original sequence version: 92 0D52F9D68193B4AC dnat-1 1 DnaT 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f4 dnat-1 2 DnaT 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f2 dnat-prib-1 3 PriB 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified DnaT 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P0A8J2:p.Asp70Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D A Wed May 02 17:21:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp70ala' Tue Jun 30 19:27:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp70Ala' direct interaction direct interaction f8e