MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Unconventional secretion of synuclein-gamma promotes tumor cell invasion. Unconventional secretion of synuclein-gamma promotes tumor cell invasion. FEBS J. (1742-464X) 2014 imex curation Liu C., Qu L., Lian S., Tian Z., Zhao C., Meng L., Shou C. scc@bjcancer.org 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions human-ht_29 Homo sapiens HT-29 caucasian women with colon adenocarcinoma ht_29 HT-29 confirmed as human with IEF of AST, LDH established from the primary tumor of a 44-year-old Caucasian woman with colon adenocarcinoma in 1964; described to be heterotransplantable forming well-differentiated grade I tumors anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot scc@bjcancer.org Accepted 2014-SEP-12 by LUANA 2014 imex curation flot2_human Flotillin-2 FLOT2 ESA1 M17S1 Epidermal surface antigen Membrane component chromosome 17 surface marker 1 protein protein human Homo sapiens Human MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV F690BFE0151D3BD7 q6fhg5_human Gamma-synuclein SNCG hCG_23263 protein protein human Homo sapiens Human MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD F183DEF302DBE688 flot2-sncg-1 1 SNCG 3 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Flotillin-2 2 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f3b The association between SNCG and Flotillin-2 in HT-29 and T47D cells was investigated by reciprocal co-immunoprecipitation experiment using the soluble fraction of Cp, which is enriched in plasma membrane and intracellular compartments fractions. As shown in Fig. 3B, interaction between endogenous SNCG and Flotillin-2 was revealed. These results showed that SNCG was associated with membrane vesicles, suggestive of a vesicle-based exporting mechanism of SNCG secretion flot2-sncg-2 1 Flotillin-2 2 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level SNCG 3 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f3b The association between SNCG and Flotillin-2 in HT-29 and T47D cells was investigated by reciprocal co-immunoprecipitation experiment using the soluble fraction of Cp, which is enriched in plasma membrane and intracellular compartments fractions. As shown in Fig. 3B, interaction between endogenous SNCG and Flotillin-2 was revealed. These results showed that SNCG was associated with membrane vesicles, suggestive of a vesicle-based exporting mechanism of SNCG secretion