IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Shared functions of plant and mammalian StAR-related lipid transfer (START) domains in modulating transcription factor activity. Shared functions of plant and mammalian StAR-related lipid transfer (START) domains in modulating transcription factor activity. BMC Biol. 2014 Schrick K., Bruno M., Khosla A., Cox P.N., Marlatt S.A., Roque R.A., Nguyen H.C., He C., Snyder M.P., Singh D., Yadav G. mbruno@stanford.edu 18-Sep-2014: Contacted by IntAct-Help. yeast Saccharomyces cerevisiae Baker's yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom ms participant Identification by mass spectrometry ms participant Schrick K., Bruno M., Khosla A., Cox P.N., Marlatt S.A., Roque R.A., Nguyen H.C., He C., Snyder M.P., Singh D., Yadav G. Only high confidence and standard matched protein-metabolite interactions have been included in this data set. mbruno@stanford.edu Accepted 2014-SEP-17 by MGT BMC Biol. 2014 taurocholic acid taurocholic acid 3alpha,7alpha,12alpha-trihydroxy-5beta-cholanic acid 24-taurine cholic acid taurine conjugate Choloyl-taurine Cholyltaurine N-choloyltaurine Taurocholate Taurocholic acid 2-[(3alpha,7alpha,12alpha-trihydroxy-24-oxo-5beta-cholan-24-yl)amino]ethanesulfonic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) WBWWGRHZICKQGZ-HZAMXZRMSA-N WBWWGRHZICKQGZ-HZAMXZRMSA-N ppct_human Phosphatidylcholine transfer protein StAR-related lipid transfer protein 2 PCTP STARD2 START domain-containing protein 2 protein protein human Homo sapiens Human MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSMPQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNYLKKT E40204B7C0A9AF83 squalene squalene (all-E)-2,6,10,15,19,23-hexamethyl-2,6,10,14,18,22-tetracosahexaene Spinacene Squalene squalene Supraene (6E,10E,14E,18E)-2,6,10,15,19,23-hexamethyltetracosa-2,6,10,14,18,22-hexaene small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) YYGNTYWPHWGJRM-AAJYLUCBSA-N YYGNTYWPHWGJRM-AAJYLUCBSA-N star_mouse Steroidogenic acute regulatory protein, mitochondrial Star Luteinizing hormone-induced protein START domain-containing protein 1 protein protein mouse Mus musculus Mouse MFLATFKLCAGSSYRHMRNMKGLRHQAVLAIGQELNWRALGDSSPGWMGQVRRRSSLLGSQLEATLYSDQELSYIQQGEVAMQKALGILNNQEGWKKESQQENGDEVLSKMVPDVGKVFRLEVVVDQPMDRLYEELVDRMEAMGEWNPNVKEIKVLQRIGKDTVITHELAAAAAGNLVGPRDFVSVRCTKRRGSTCVLAGMATHFGEMPEQSGVIRAEHGPTCMVLHPLAGSPSKTKLTWLLSIDLKGWLPKTIINQVLSQTQIEFANHLRKRLEASPASEAQC 9BB13E52D4439B72 vitamin e vitamin E vitamin E small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) alpha-tocotrienol alpha-tocotrienol alpha-tocotrienol alpha-tocotrienol zeta1-tocopherol (2R)-2,5,7,8-tetramethyl-2-[(3E,7E)-4,8,12-trimethyltrideca-3,7,11-trien-1-yl]-3,4-dihydro-2H-chromen-6-ol small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) RZFHLOLGZPDCHJ-XZXLULOTSA-N RZFHLOLGZPDCHJ-XZXLULOTSA-N lanosterol lanosterol (3beta)-lanosta-8,24-dien-3-ol (3beta,5alpha)-4,4,14-trimethylcholesta-8,24-dien-3-ol 4,4',14alpha-Trimethyl-5alpha-cholesta-8,24-dien-3beta-ol Lanosterin Lanosterol LANOSTEROL lanosterol lanosta-8,24-dien-3beta-ol small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) CAHGCLMLTWQZNJ-BQNIITSRSA-N CAHGCLMLTWQZNJ-BQNIITSRSA-N hgl2_arath Homeobox-leucine zipper protein GLABRA 2 GL2 ATHB10 HD-ZIP protein ATHB-10 Homeobox-leucine zipper protein ATHB-10 F19K16.20 At1g79840 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSMAVDMSSKQPTKDFFSSPALSLSLAGIFRNASSGSTNPEEDFLGRRVVDDEDRTVEMSSENSGPTRSRSEEDLEGEDHDDEEEEEEDGAAGNKGTNKRKRKKYHRHTTDQIRHMEALFKETPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIKAIQERHENSLLKAELEKLREENKAMRESFSKANSSCPNCGGGPDDLHLENSKLKAELDKLRAALGRTPYPLQASCSDDQEHRLGSLDFYTGVFALEKSRIAEISNRATLELQKMATSGEPMWLRSVETGREILNYDEYLKEFPQAQASSFPGRKTIEASRDAGIVFMDAHKLAQSFMDVGQWKETFACLISKAATVDVIRQGEGPSRIDGAIQLMFGEMQLLTPVVPTREVYFVRSCRQLSPEKWAIVDVSVSVEDSNTEKEASLLKCRKLPSGCIIEDTSNGHSKVTWVEHLDVSASTVQPLFRSLVNTGLAFGARHWVATLQLHCERLVFFMATNVPTKDSLGVTTLAGRKSVLKMAQRMTQSFYRAIAASSYHQWTKITTKTGQDMRVSSRKNLHDPGEPTGVIVCASSSLWLPVSPALLFDFFRDEARRHEWDALSNGAHVQSIANLSKGQDRGNSVAIQTVKSREKSIWVLQDSSTNSYESVVVYAPVDINTTQLVLAGHDPSNIQILPSGFSIIPDGVESRPLVITSTQDDRNSQGGSLLTLALQTLINPSPAAKLNMESVESVTNLVSVTLHNIKRSLQIEDC A2C77ABF87F64273 star-vitamin_e 1 5 unspecified role unspecified role bait bait c-terminal zz tag zz tag ZZ tag ZZ tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminal gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind range range range range c-terminal vp16 ad vp16 activation domain vp16 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role prey prey physical association physical association Fig. 5D star-taurocholic_acid 1 5 unspecified role unspecified role bait bait c-terminal zz tag zz tag ZZ tag ZZ tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind range range range range n-terminal gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal vp16 ad vp16 activation domain vp16 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range 2 unspecified role unspecified role prey prey physical association physical association Fig. 5D star-squalene 1 5 unspecified role unspecified role bait bait c-terminal zz tag zz tag ZZ tag ZZ tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminal gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind range range range range c-terminal vp16 ad vp16 activation domain vp16 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role prey prey physical association physical association Fig. 5D star-lanosterol 1 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait c-terminal zz tag zz tag ZZ tag ZZ tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal vp16 ad vp16 activation domain vp16 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind range range range range n-terminal gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 5D gl2-alpha_tocotrienol 1 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait start domain sufficient to bind sufficient binding region sufficient to bind range range range range n-terminal gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal vp16 ad vp16 activation domain vp16 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal zz tag zz tag ZZ tag ZZ tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association ppct-taurocholic_acid 1 2 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait c-terminal zz tag zz tag ZZ tag ZZ tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminal gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal vp16 ad vp16 activation domain vp16 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association Fig. 5D ppct-squalene 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait c-terminal zz tag zz tag ZZ tag ZZ tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminal gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal vp16 ad vp16 activation domain vp16 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association Fig. 5D ppct-lanosterol 1 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range c-terminal vp16 ad vp16 activation domain vp16 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminal gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal zz tag zz tag ZZ tag ZZ tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role prey prey physical association physical association Fig. 5D