MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Rubisco Accumulation Factor 1 from Thermosynechococcus elongatus participates in the final stages of ribulose-1,5-bisphosphate carboxylase/oxygenase assembly in Escherichia coli cells and in vitro. Rubisco Accumulation Factor 1 from Thermosynechococcus elongatus participates in the final stages of ribulose-1,5-bisphosphate carboxylase/oxygenase assembly in Escherichia coli cells and in vitro. FEBS J. (1742-464X) 2014 imex curation Kolesinski P., Belusiak I., Czarnocki-Cieciura M., Szczepaniak A. piotr.kolesinski@ibmb.uni.wroc.pl 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot piotr.kolesinski@ibmb.uni.wroc.pl Accepted 2014-JUL-09 by LUANA 2014 imex curation Rubisco Accumulation Factor 1 from Thermosynechococcus elongatus participates in the final stages of ribulose-1,5-bisphosphate carboxylase/oxygenase assembly in Escherichia coli cells and in vitro. Rubisco Accumulation Factor 1 from Thermosynechococcus elongatus participates in the final stages of ribulose-1,5-bisphosphate carboxylase/oxygenase assembly in Escherichia coli cells and in vitro. FEBS J. (1742-464X) 2014 imex curation Kolesinski P., Belusiak I., Czarnocki-Cieciura M., Szczepaniak A. piotr.kolesinski@ibmb.uni.wroc.pl 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined piotr.kolesinski@ibmb.uni.wroc.pl Accepted 2014-JUL-09 by LUANA 2014 imex curation raf1_theeb RuBisCO accumulation factor 1 raf1 tlr1766 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MSQDQDALTTEVLQRLRRKEGTWQDWGAGCRQLQKQGLSPQAIFEATGIEPIHQNQLITALQVSQSLGEAPESVRAYFQTRGSDLLYELRVLSAGDRLAAATLIVEKQLDVTAVHEVCRALKAVSYRKDNSEGFGESVGDRIGRYYWQLARQQRDLAQRSRLIAQGLRFVESASGRQALEKLLTDFTVVPAVNQPRLPLYRLDTAEEVPYLVPVAGTAPLTATVLQQVPRLSCTEVFRVVAVPQGMSLVALPAWQVLLNAVDPVAILWPAADLPAELPPSPEGLPIAQVLLVVDRGLAEWDRDRYLLIAPSPSEAVQLAWLPEPPTATVVGQLLLVLRPPQVLDESLNRELWFFEE ABA5654DB71966A9 rbl_theeb Ribulose bisphosphate carboxylase large chain cbbL rbcL tll1506 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MAYTQSKSQKVGYQAGVKDYRLTYYTPDYTPKDTDILAAFRVTPQPGVPFEEAAAAVAAESSTGTWTTVWTDLLTDLDRYKGCCYDIEPLPGEDNQFIAYIAYPLDLFEEGSVTNMLTSIVGNVFGFKALKALRLEDLRIPVAYLKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENINSQPFQRWRDRFLFVADAIHKAQAETGEIKGHYLNVTAPTCEEMLKRAEFAKELEMPIIMHDFLTAGFTANTTLSKWCRDNGMLLHIHRAMHAVMDRQKNHGIHFRVLAKCLRMSGGDHIHTGTVVGKLEGDKAVTLGFVDLLRENYIEQDRSRGIYFTQDWASMPGVMAVASGGIHVWHMPALVDIFGDDAVLQFGGGTLGHPWGNAPGATANRVALEACIQARNEGRDLMREGGDIIREAARWSPELAAACELWKEIKFEFEAQDTI B4A97CD4D6A3EB91 cbbl-q8di26 1 RAF1 3 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified tag strep tag strep tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RbcL 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f2c cbbl-q8di26-1 2 RbcL 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified RAF1 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction f4