UniProt UniProt http://www.uniprot.org Virus entry. Lassa virus entry requires a trigger-induced receptor switch. Virus entry. Lassa virus entry requires a trigger-induced receptor switch. Science (0036-8075) 2014 imex curation Jae L.T., Raaben M., Herbert A.S., Kuehne A.I., Wirchnianski A.S., Soh T.K., Stubbs S.H., Janssen H., Damme M., Saftig P., Whelan S.P., Dye J.M., Brummelkamp T.R. Origin of Flag-tagged Lassa-GP (provided by Dr. S. Kunz) according 17761532 (Kunz cloned LFVGP (Josiah) C-terminal Flag-tagged); maps also to UniProt LFV reference proteome t.brummelkamp@nki.nl 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Jae L.T., Raaben M., Herbert A.S., Kuehne A.I., Wirchnianski A.S., Soh T.K., Stubbs S.H., Janssen H., Damme M., Saftig P., Whelan S.P., Dye J.M., Brummelkamp T.R. Flag-tagged Lassa-GP was produced in HEK-293T cells lacking alpha-dystroglycan and LAMP1. Lassa-GP was immobilizd on anti-FLAG beads, washed and incubated with respective cell lysates for immunoblot analysis (HEK-293T , MEK, chicken or HAP1) . Origin of Flag-tagged Lassa-GP (provided by Dr. S. Kunz) according 17761532 (Kunz cloned LFVGP (Josiah) C-terminal Flag-tagged); maps also to UniProt LFV reference proteome t.brummelkamp@nki.nl Accepted 2014-AUG-21 by ORCHARD Science (0036-8075) 2014 imex curation dag1_human Dystroglycan 1 DAG1 Dystrophin-associated glycoprotein 1 Dystroglycan protein protein human Homo sapiens Human MRMSVGLSLLLPLSGRTFLLLLSVVMAQSHWPSEPSEAVRDWENQLEASMHSVLSDLHEAVPTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGLPLDTDKGVHYISVSATRLGANGSHIPQTSSVFSIEVYPEDHSELQSVRTASPDPGEVVSSACAADEPVTVLTVILDADLTKMTPKQRIDLLHRMRSFSEVELHNMKLVPVVNNRLFDMSAFMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIHGVEAPAREGAMSAQLGYPVVGWHIANKKPPLPKRVRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTMTIPGYVEPTAVATPPTTTTKKPRVSTPKPATPSTDSTTTTTRRPTKKPRTPRPVPRVTTKVSITRLETASPPTRIRTTTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDHEDTTTDKLKLTLKLREQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQGDRAPARFKAKFVGDPALVLNDIHKKIALVKKLAFAFGDRNCSTITLQNITRGSIVVEWTNNTLPLEPCPKEQIAGLSRRIAEDDGKPRPAFSNALEPDFKATSITVTGSGSCRHLQFIPVVPPRRVPSEAPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKGKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETTPLNQDTMGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP DIP protein Q14118 original sequence version: 76 3AF6CBB0DCF91962 glyc_lassj Pre-glycoprotein polyprotein GP complex GPC GP-C protein protein lasv Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) LASV MGQIVTFFQEVPHVIEEVMNIVLIALSVLAVLKGLYNFATCGLVGLVTFLLLCGRSCTTSLYKGVYELQTLELNMETLNMTMPLSCTKNNSHHYIMVGNETGLELTLTNTSIINHKFCNLSDAHKKNLYDHALMSIISTFHLSIPNFNQYEAMSCDFNGGKISVQYNLSHSYAGDAANHCGTVANGVLQTFMRMAWGGSYIALDSGRGNWDCIMTSYQYLIIQNTTWEDHCQFSRPSPIGYLGLLSQRTRDIYISRRLLGTFTWTLSDSEGKDTPGGYCLTRWMLIEAELKCFGNTAVAKCNEKHDEEFCDMLRLFDFNKQAIQRLKAEAQMSIQLINKAVNALINDQLIMKNHLRDIMGIPYCNYSKYWYLNHTTTGRTSLPKCWLVSNGSYLNETHFSDDIEQQADNMITEMLQKEYMERQGKTPLGLVDLFVFSTSFYLISIFLHLVKIPTHRHIVGKSCPKPHRLNHMGICSCGLYKQPGVPVKWKR mint A291367FC5BC70C8 lamp1_human Lysosome-associated membrane glycoprotein 1 CD107 antigen-like family member A LAMP1 protein protein human Homo sapiens Human MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGPKNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFFLQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAFSVNIFKVWVQAFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI DIP protein P11279 original sequence version: 147 3E0A285744DD6588 dag1_mouse Dystroglycan 1 Dag1 Dystrophin-associated glycoprotein 1 Dystroglycan protein protein mouse Mus musculus Mouse MSVDNWLLHPLWGQTFLLLLSVAVAQAHWPSEPSEAVRDWKNQLEASMHSVLSDFQEAVPTVVGIPDGTAVVGRSFRVSIPTDLIASSGEIIKVSAAGKEALPSWLHWDPHSHILEGLPLDTDKGVHYISVSAARLGANGSHVPQTSSVFSIEVYPEDHNEPQSVRAASSDPGEVVPSACAADEPVTVLTVILDADLTKMTPKQRIDLLNRMQSFSEVELHNMKLVPVVNNRLFDMSAFMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIRGVETPAREGAMSAQLGYPVVGWHIANKKPTLPKRLRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTLTIPGYVEPTAVITPPTTTTKKPRVSTPKPATPSTDSSTTTTRRPTKKPRTPRPVPRVTTKAPITRLETASPPTRIRTTTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDNEDTTTDKLKLTLKLREQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHKRPQGDKAPARFKARLAGDPAPVVNDIHKKIALVKKLAFAFGDRNCSSITLQNITRGSIVVEWTNNTLPLEPCPKEQIIGLSRRIADENGKPRPAFSNALEPDFKALSIAVTGSGSCRHLQFIPVAPPSPGSSAAPATEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKGKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSMPETTPLNQDTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP 59C081EA86AB0AC1 lamp1_mouse Lysosome-associated membrane glycoprotein 1 Lysosomal membrane glycoprotein A 120 kDa lysosomal membrane glycoprotein LGP-120 P2B CD107 antigen-like family member A Lamp1 Lamp-1 protein protein mouse Mus musculus Mouse MAAPGARRPLLLLLLAGLAHGASALFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEECVQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI C1BD373548BB9655 a4var9_chick Alpha-dystroglycan DAG1 Beta-dystroglycan Dystroglycan Dystrophin-associated glycoprotein 1 protein protein chick Gallus gallus (Chicken) Chicken MTVGCVPQPPFLGRTLLPVLLLAASARCHWPSEPAEVVRDWENQLEASMHSVLSDLRETVPAVVGIPDSSAVVGRFFRVSIPTDLIASNGEAVQVSEAGKESLPSWLHWNAESSSLEGLPLDTDKGVHYISVTTLQPFPNGSYVPQAANVFSVEVHQEDHSEPQSLRAAAQEAGDAAPFVCGAEEPVTILTVILDADLTKMTPKQRIELLNRMRSFSEVELHNMKLVPVVNNRLFDMSAFMAGPGNAKKVVENGALLSWKLGCSLSQNSVPNISKVEAPAKEGTMSARLGYPVVGWHIANKKPHLPKRMRRQINATPTPLTAIGPPTTAAQEPPTRIVPTPTSPAIAPPTETTAPPVREPIPLPRKPTVTIRTRGPIVQTPTLGPIQPTRLVEGTGTVSVPIRPTVPGYVEPTAVITPPTTTTKKPRVSTLKPATPSTTDSSTATTRRPTRRPKTPRPTKPPSTTRSTISKLTTASPPTRVRTTASGVPRPWEPNEPPKLTNHIDRVDAWEGTYFEVKIPSDTFYDKEDTTTDKLQLTLKLKEQQMIEENSWVQFNSTSQLMYGMPDRSHVGKHEYFMYATDKGGLFAVDAFEIHVHKRPHGDKSPVKFKARLEGDHSAVANDIHKKIMLVKKLALAFGDRNSSTITVQDIAKGSIVVEWTNNTLPLEPCPREQIRTLSKKIAEDSGGASPAFSNILQPEFKPLNVSVVGSGSCGHIQFVPVTKDGRVISEATPTLAAGKDPEKSSEDDVYLHTVIPAVVVAAILLVAGIIAMICYRKKRKGKLTIEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSMPETTPLNQDTIGEYTPLRDEDPIAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP C8ED6979EDAB3E59 gpc-lamp1 1 3 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 4 unspecified role unspecified role prey prey cell lysate cell lysate human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association 2A and S8A At pH 6.5 and 5.5 gpc-dag1 1 3 unspecified role unspecified role bait bait partially purified partially purified c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 2 unspecified role unspecified role prey prey cell lysate cell lysate human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association 2A and S8A At pH 8.0; lost at pH 6.5 and 5.5 gpc-dag1-2 1 3 unspecified role unspecified role bait bait partially purified partially purified c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role prey prey cell lysate cell lysate mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. physical association physical association 2B and 4 At pH 8.0; lost at pH 5.5 Interaction is lost upon deletion of TMEM5 in mouse, no effect by deletion of ST3GAL4 gpc-lamp1-2 1 3 unspecified role unspecified role bait bait partially purified partially purified c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 6 unspecified role unspecified role prey prey cell lysate cell lysate mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. physical association physical association 2B and 4 At pH 5.5; lost at pH 8.0 Interaction is lost upon deletion of ST3GAL4 in mouse, no effect by deletion of TMEM5 gpc-dag1-4 1 3 unspecified role unspecified role bait bait partially purified partially purified c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 7 unspecified role unspecified role prey prey cell lysate cell lysate chick Gallus gallus (Chicken) Chicken physical association physical association 2B At pH 8.0; lost at pH 5.5 gpc-lamp1-3 1 3 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 4 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fc-igg1 fc-igg1 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction 2D At pH 6.0, 5.5 and 4.5; lost at pH 8.0; lost at pH 4.0 when LSF GP1 is fully released from GP2. gpc-lamp1-4 1 3 unspecified role unspecified role bait bait partially purified partially purified c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 4 unspecified role unspecified role prey prey cell lysate cell lysate human-hap1 Homo sapiens HAP1 fibroblast-like cells derived from KBM-7 hap1 Human HAP1 fibroblast-like cells physical association physical association 3B At pH 5.5 Interaction is lost upon deletion of ST3GAL4 in HAP1 cells gpc-lamp1-5 1 3 unspecified role unspecified role bait bait partially purified partially purified c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 4 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection P11279:p.Asn76Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain N S Wed May 02 17:39:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn76ser' Tue Jun 30 15:47:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn76Ser' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association 3E At pH 5.5