MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Structure of RPA32 bound to N-terminus of SMARCAL1 redefines the binding interface between RPA32 and its interacting proteins. Structure of RPA32 bound to N-terminus of SMARCAL1 redefines the binding interface between RPA32 and its interacting proteins. FEBS J. (1742-464X) 2014 imex curation Xie S., Lu Y., Jakoncic J., Sun H., Xia J., Qian C. cmqian@hku.hk 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined cmqian@hku.hk Accepted 2014-JUN-06 by LUANA 2014 imex curation Structure of RPA32 bound to N-terminus of SMARCAL1 redefines the binding interface between RPA32 and its interacting proteins. Structure of RPA32 bound to N-terminus of SMARCAL1 redefines the binding interface between RPA32 and its interacting proteins. FEBS J. (1742-464X) 2014 imex curation Xie S., Lu Y., Jakoncic J., Sun H., Xia J., Qian C. cmqian@hku.hk 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined cmqian@hku.hk Accepted 2014-JUN-06 by LUANA 2014 imex curation Structure of RPA32 bound to N-terminus of SMARCAL1 redefines the binding interface between RPA32 and its interacting proteins. Structure of RPA32 bound to N-terminus of SMARCAL1 redefines the binding interface between RPA32 and its interacting proteins. FEBS J. (1742-464X) 2014 imex curation Xie S., Lu Y., Jakoncic J., Sun H., Xia J., Qian C. cmqian@hku.hk 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined cmqian@hku.hk Accepted 2014-JUN-06 by LUANA 2014 imex curation Structure of RPA32 bound to N-terminus of SMARCAL1 redefines the binding interface between RPA32 and its interacting proteins. Structure of RPA32 bound to N-terminus of SMARCAL1 redefines the binding interface between RPA32 and its interacting proteins. FEBS J. (1742-464X) 2014 imex curation Xie S., Lu Y., Jakoncic J., Sun H., Xia J., Qian C. cmqian@hku.hk 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined cmqian@hku.hk Accepted 2014-JUN-06 by LUANA 2014 imex curation rfa2_human Replication protein A 32 kDa subunit RPA34 Replication protein A 34 kDa subunit Replication factor A protein 2 RPA2 REPA2 RPA32 protein protein human Homo sapiens Human MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE DIP protein P15927 original sequence version: 119 DIP protein P15927-1 original sequence version: 125 DIP protein P15927 original sequence version: 114 61A563EA7B34A9B1 ung_human Uracil-DNA glycosylase UNG DGU UNG15 UNG1 protein protein human Homo sapiens Human MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL A4B27E6198AFE9C0 tipin_human TIMELESS-interacting protein TIPIN protein protein human Homo sapiens Human MLEPQENGVIDLPDYEHVEDETFPPFPPPASPERQDGEGTEPDEESGNGAPVRVPPKRTVKRNIPKLDAQRLISERGLPALRHVFDKAKFKGKGHEAEDLKMLIRHMEHWAHRLFPKLQFEDFIDRVEYLGSKKEVQTCLKRIRLDLPILHEDFVSNNDEVAENNEHDVTSTELDPFLTNLSESEMFASELSRSLTEEQQQRIERNKQLALERRQAKLLSNSQTLGNDMLMNTPRAHTVEEVNTDEDQKEESNGLNEDILDNPCNDAIANTLNEEETLLDQSFKNVQQQLDATSRNITEAR DIP protein Q9BVW5 original sequence version: 102 B0C69117A636CE3A smal1_human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 SMARCAL1 HARP HepA-related protein Sucrose nonfermenting protein 2-like 1 protein protein human Homo sapiens Human MSLPLTEEQRKKIEENRQKALARRAEKLLAEQHQRTSSGTSIAGNPFQAKQGPSQNFPRESCKPVSHGVIFKQQNLSSSSNADQRPHDSHSFQAKGIWKKPEEMPTACPGHSPRSQMALTGISPPLAQSPPEVPKQQLLSYELGQGHAQASPEIRFTPFANPTHKPLAKPKSSQETPAHSSGQPPRDAKLEAKTAKASPSGQNISYIHSSSESVTPRTEGRLQQKSGSSVQKGVNSQKGKCVRNGDRFQVLIGYNAELIAVFKTLPSKNYDPDTKTWNFSMNDYSALMKAAQSLPTVNLQPLEWAYGSSESPSTSSEGQAGLPSAPSLSFVKGRCMLISRAYFEADISYSQDLIALFKQMDSRRYDVKTRKWSFLLEEHSKLIAKVRCLPQVQLDPLPTTLTLAFASQLKKTSLSLTPDVPEADLSEVDPKLVSNLMPFQRAGVNFAIAKGGRLLLADDMGLGKTIQAICIAAFYRKEWPLLVVVPSSVRFTWEQAFLRWLPSLSPDCINVVVTGKDRLTAGLINIVSFDLLSKLEKQLKTPFKVVIIDESHFLKNSRTARCRAAMPVLKVAKRVILLSGTPAMSRPAELYTQIIAVKPTFFPQFHAFGLRYCDAKRMPWGWDYSGSSNLGELKLLLEEAVMLRRLKSDVLSQLPAKQRKIVVIAPGRINARTRAALDAAAKEMTTKDKTKQQQKDALILFFNRTAEAKIPSVIEYILDLLESGREKFLVFAHHKVVLDAITQELERKHVQHIRIDGSTSSAEREDLCQQFQLSERHAVAVLSITAANMGLTFSSADLVVFAELFWNPGVLIQAEDRVHRIGQTSSVGIHYLVAKGTADDYLWPLIQEKIKVLAEAGLSETNFSEMTESTDYLYKDPKQQKIYDLFQKSFEKEGSDMELLEAAESFDPGSASGTSGSSSQNMGDTLDESSLTASPQKKRRFEFFDNWDSFTSPL C5C762C24A2FDD3A rpa2-smarcal1 4 RPA32 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SMARCAL1 8 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction t1 f1 sf1 rpa2-smarcal1-1 2 RPA32 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SMARCAL1 8 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9NZC9:p.Arg17_Lys19delinsAlaAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain RQK AAA Thu Jul 07 12:18:18 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was arg17ala_gln18ala_lys19ala Fri Jul 22 10:59:49 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'arg17ala,gln18ala,lys19ala' Wed May 02 19:36:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg_gln_lys17-19ala_ala_ala' Tue Jun 30 16:17:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg17_Lys19delinsAlaAlaAla' direct interaction direct interaction f3 sf5 rpa2-smarcal1-2 3 RPA32 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SMARCAL1 8 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f4 t2 rpa2-smarcal1-3 3 RPA32 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SMARCAL1 8 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f4 t2 rpa2-smarcal1-4 3 RPA32 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SMARCAL1 8 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9NZC9:p.Arg17_Lys19delinsAlaAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain RQK AAA Thu Jul 07 12:17:08 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was arg17ala_gln18ala_lys19ala Fri Jul 22 10:56:05 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'arg17ala,gln18ala,lys19ala' Wed May 02 17:33:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg_gln_lys17-19ala_ala_ala' Tue Jun 30 17:12:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg17_Lys19delinsAlaAlaAla' direct interaction direct interaction f4 t2 rpa2-smarcal1-5 3 RPA32 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SMARCAL1 8 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q9NZC9:p.Asn16_Arg17delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain NR AA Thu Jul 07 12:16:51 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was asn16ala_arg17ala Fri Jul 22 11:02:30 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'asn16ala,arg17ala' Wed May 02 19:18:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn_arg16-17ala_ala' Tue Jun 30 17:53:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn16_Arg17delinsAlaAla' range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f4 t2 rpa2-smarcal1-6 3 RPA32 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SMARCAL1 8 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9NZC9:p.Lys27Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K A Wed May 02 19:34:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys27ala' Tue Jun 30 17:32:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys27Ala' direct interaction direct interaction f4 t2 rpa2-smarcal1-7 3 RPA32 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SMARCAL1 8 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q9NZC9:p.Lys12_Ile13delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain KI AA Thu Jul 07 12:18:08 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was lys12ala_ile13ala Fri Jul 22 11:12:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys12ala,ile13ala' Wed May 02 19:25:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys_ile12-13ala_ala' Tue Jun 30 17:08:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys12_Ile13delinsAlaAla' range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f4 t2 rpa2-smarcal1-8 3 RPA32 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SMARCAL1 8 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9NZC9:p.Leu5Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 17:14:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu5ala' Tue Jun 30 16:07:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu5Ala' direct interaction direct interaction f4 t2 rpa2-smarcal1-9 3 RPA32 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SMARCAL1 8 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9NZC9:p.Ala20_Leu21delinsSerSer mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain AL SS Thu Jul 07 12:17:49 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was ala20ser_leu21ser Fri Jul 22 11:00:01 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ala20ser,leu21ser' Wed May 02 17:56:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala_leu20-21ser_ser' Tue Jun 30 17:00:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala20_Leu21delinsSerSer' direct interaction direct interaction f4 t2 rpa2-smarcal1-10 3 RPA32 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SMARCAL1 8 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q9NZC9:p.Gln9Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Q A Wed May 02 15:16:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln9ala' Tue Jun 30 15:59:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln9Ala' range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f4 t2 rpa2-smarcal1-11 3 RPA32 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain UNG2 6 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f5a t2 rpa2-ung-1 3 RPA32 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain UNG2 6 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P13051:p.Arg76_Lys78delinsAlaAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain RNK AAA Thu Jul 07 12:18:23 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was arg76ala_asn77ala_lys78ala Fri Jul 22 10:51:42 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'arg76ala,asn77ala,lys78ala' Wed May 02 14:29:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg_asn_lys76-78ala_ala_ala' Tue Jun 30 16:06:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg76_Lys78delinsAlaAlaAla' direct interaction direct interaction f5a t2 rpa2-ung-2 3 RPA32 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain UNG2 6 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P13051:p.Arg88Cys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R C Wed May 02 15:20:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg88cys' Tue Jun 30 17:43:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg88Cys' range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f5a t2 rpa2-ung-3 3 RPA32 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Tipin 7 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f5c t2 rpa2-tipin 3 RPA32 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Tipin 7 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9BVW5:p.Leu195Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 19:11:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu195ala' Tue Jun 30 20:13:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu195Ala' direct interaction direct interaction f5c t2 rpa2-ung-4 2 RPA32 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain UNG2 6 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P13051:p.Arg76_Lys78delinsAlaAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain RNK AAA Thu Jul 07 12:17:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was arg76ala_asn77ala_lys78ala Fri Jul 22 10:50:29 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'arg76ala,asn77ala,lys78ala' Wed May 02 19:10:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg_asn_lys76-78ala_ala_ala' Tue Jun 30 19:21:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg76_Lys78delinsAlaAlaAla' range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f5b sf4 rpa2-tipin-1 2 RPA32 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Tipin 7 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q9BVW5:p.Leu195Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 17:51:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu195ala' Tue Jun 30 15:56:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu195Ala' range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f5d rpa2-smarcal1-12 1 RPA32 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SMARCAL1 8 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction sf2