IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Regulation of the VHL/HIF-1 Pathway by DJ-1. Regulation of the VHL/HIF-1 Pathway by DJ-1. J. Neurosci. (0270-6474) 2014 imex curation Parsanejad M., Zhang Y., Qu D., Irrcher I., Rousseaux M.W., Aleyasin H., Kamkar F., Callaghan S., Slack R.S., Mak T.W., Lee S., Figeys D., Park D.S. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. I have NOT entered results from "MS screen" - as this is in another publication - which is in IntAct already. Neither have I entered results form fig 4 - Ubiquitinqtion Assay - as only an IP is used for source of VHL (enzyme). Email sent 7-8/8/14 Results using the plasmid "FLAG-VHL-GFP" (as used in Fig 1B )have not been included as the origins of the VHL cannot be determined from this publication and the authors have not replied to a request for information. Results from Fig 4 (Ubiquitinqtion Assay) have not been included as only an impure (IP) source of VHL (enzyme) is used. dpark@uottawa.ca 12-Nov-2014: Contacted by IntAct-Help. Only protein-protein interactions human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Parsanejad M., Zhang Y., Qu D., Irrcher I., Rousseaux M.W., Aleyasin H., Kamkar F., Callaghan S., Slack R.S., Mak T.W., Lee S., Figeys D., Park D.S. Parkinsons - Interactions investigated in the context of Parkinsons disease I have NOT entered results from "MS screen" - as this is in another publication - which is in IntAct already. Neither have I entered results form fig 4 - Ubiquitinqtion Assay - as only an IP is used for source of VHL (enzyme). Email sent 7-8/8/14 Results using the plasmid "FLAG-VHL-GFP" (as used in Fig 1B )have not been included as the origins of the VHL cannot be determined from this publication and the authors have not replied to a request for information. Results from Fig 4 (Ubiquitinqtion Assay) have not been included as only an impure (IP) source of VHL (enzyme) is used. dpark@uottawa.ca Accepted 2014-OCT-23 by ORCHARD J. Neurosci. (0270-6474) 2014 Only protein-protein interactions imex curation park7_human Parkinson disease protein 7 PARK7 Oncogene DJ1 Parkinsonism-associated deglycase Maillard deglycase Protein DJ-1 Protein/nucleic acid deglycase DJ-1 protein protein human Homo sapiens Human MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD DIP protein Q99497 original sequence version: 102 4B21661B3A76BC67 vhl_human von Hippel-Lindau disease tumor suppressor VHL pVHL Protein G7 protein protein human Homo sapiens Human MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD DIP protein P40337 original sequence version: 176 DIP protein P40337 original sequence version: 103 DIP protein P40337-1 original sequence version: 177 DIP protein P40337 original sequence version: 160 DIP protein P40337 original sequence version: 175 BA5D6765FBC16EA7 vhl-park7 1 3 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey physical association physical association 1A