MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Analysis of 5-lipoxygenase phosphorylation on molecular level by MALDI-MS. Analysis of 5-lipoxygenase phosphorylation on molecular level by MALDI-MS. FEBS J. (1742-464X) 2014 imex curation Markoutsa S., Sürün D., Karas M., Hofmann B., Steinhilber D., Sorg B.L. b.sorg@pharmchem.uni-frankfurt.de 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot b.sorg@pharmchem.uni-frankfurt.de Accepted 2014-FEB-17 by LUANA 2014 imex curation Analysis of 5-lipoxygenase phosphorylation on molecular level by MALDI-MS. Analysis of 5-lipoxygenase phosphorylation on molecular level by MALDI-MS. FEBS J. (1742-464X) 2014 imex curation Markoutsa S., Sürün D., Karas M., Hofmann B., Steinhilber D., Sorg B.L. b.sorg@pharmchem.uni-frankfurt.de 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay ms participant Identification by mass spectrometry ms participant b.sorg@pharmchem.uni-frankfurt.de Accepted 2014-FEB-17 by LUANA 2014 imex curation Analysis of 5-lipoxygenase phosphorylation on molecular level by MALDI-MS. Analysis of 5-lipoxygenase phosphorylation on molecular level by MALDI-MS. FEBS J. (1742-464X) 2014 imex curation Markoutsa S., Sürün D., Karas M., Hofmann B., Steinhilber D., Sorg B.L. b.sorg@pharmchem.uni-frankfurt.de 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay autoradiography autoradiography b.sorg@pharmchem.uni-frankfurt.de Accepted 2014-FEB-17 by LUANA 2014 imex curation lox5_human Polyunsaturated fatty acid 5-lipoxygenase ALOX5 LOG5 Arachidonate 5-lipoxygenase protein protein human Homo sapiens Human MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI DIP protein P09917 original sequence version: 164 36F38C0A9E86BB21 hck_human Tyrosine-protein kinase HCK HCK Hemopoietic cell kinase p59-HCK/p60-HCK Hematopoietic cell kinase p59Hck p61Hck protein protein human Homo sapiens Human MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVPCMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPENCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP DIP protein P08631 original sequence version: 120 DIP protein P08631 original sequence version: 150 DIP protein P08631-1 original sequence version: 163 847E877A0A641725 kcc2g_human Calcium/calmodulin-dependent protein kinase type II subunit gamma CAMK CAMK-II CAMK2G CAMKG protein protein human Homo sapiens Human MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKLKGAILTTMLVSRNFSAAKSLLNKKSDGGVKKRKSSSSVHLMPQSNNKNSLVSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKGRVPEGRSSRDRTAPSAGMQPQPSLCSSAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ DIP protein Q13555 original sequence version: 104 DIP protein Q13555 original sequence version: 109 7D61AB799B8F8CEB yes_human Tyrosine-protein kinase Yes p61-Yes Proto-oncogene c-Yes YES1 YES protein protein human Homo sapiens Human MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQIINNTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEIRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHYTEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGENL DIP protein P07947 original sequence version: 131 DIP protein P07947 original sequence version: 148 DIP protein P07947 original sequence version: 140 A2B376084686BBCD mapk2_human MAP kinase-activated protein kinase 2 MAPKAPK2 protein protein human Homo sapiens Human MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH E4EFFF11CCF288DC kapca_human cAMP-dependent protein kinase catalytic subunit alpha PRKACA PKACA protein protein human Homo sapiens Human MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF DIP protein P17612 original sequence version: 171 DIP protein P17612 original sequence version: 175 DIP protein P17612 original sequence version: 178 DIP protein P17612-1 original sequence version: 177 DIP protein P17612 original sequence version: 186 DIP protein P17612 original sequence version: 102 DIP protein P17612-1 original sequence version: 102 BF6D3ECD2614E5AB fgr_human Tyrosine-protein kinase Fgr SRC2 Proto-oncogene c-Fgr FGR p55-Fgr Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog p58-Fgr p58c-Fgr protein protein human Homo sapiens Human MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEARTEDDLTFTKGEKFHILNNTEGDWWEARSLSSGKTGCIPSNYVAPVDSIQAEEWYFGKIGRKDAERQLLSPGNPQGAFLIRESETTKGAYSLSIRDWDQTRGDHVKHYKIRKLDMGGYYITTRVQFNSVQELVQHYMEVNDGLCNLLIAPCTIMKPQTLGLAKDAWEISRSSITLERRLGTGCFGDVWLGTWNGSTKVAVKTLKPGTMSPKAFLEEAQVMKLLRHDKLVQLYAVVSEEPIYIVTEFMCHGSLLDFLKNPEGQDLRLPQLVDMAAQVAEGMAYMERMNYIHRDLRAANILVGERLACKIADFGLARLIKDDEYNPCQGSKFPIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMNKREVLEQVEQGYHMPCPPGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQT 6B8C1E08414E0F9C alox5-mapkapk2 2 MK2 8 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant enzyme enzyme neutral component neutral component purified purified 5-LO 4 ms participant Identification by mass spectrometry ms participant ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component purified purified phoser271 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation Fig. 2, Table 1 P49137 is required for phosphorylation of P09917 P09917 Ser-271 O-phospho-L-serine alox5-mapkapk2-1 2 PKA 9 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant enzyme enzyme neutral component neutral component purified purified 5-LO 4 ms participant Identification by mass spectrometry ms participant ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component purified purified phoser670 porphres porphyrin modified residue PorphRes modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain phoser271 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain phoser523 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain phoser447 porphres porphyrin modified residue PorphRes modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation Table 1 P17612 is required for phosphorylation of P09917 P09917 Ser-271, Ser-447, Ser-523 and Ser-670 O-phospho-L-serine alox5-prkaca 2 5-LO 4 ms participant Identification by mass spectrometry ms participant ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component purified purified photyr42 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain photyr53 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain photyr445 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli Fgr 10 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant enzyme enzyme neutral component neutral component purified purified phosphorylation phosphorylation reaction phosphorylation Table 2 P09769 is required for phosphorylation of P09917 P09917 Tyr-42, Tyr-53 and Tyr-445 O4'-phospho-L-tyrosine alox5-fgr 2 5-LO 4 ms participant Identification by mass spectrometry ms participant ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component purified purified photyr42 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain photyr94 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain photyr53 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli HCK 5 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant enzyme enzyme neutral component neutral component purified purified phosphorylation phosphorylation reaction phosphorylation Table 2 P08631 is required for phosphorylation of P09917 P09919 Tyr-42, Tyr-53 an Tyr-94 O4'-phospho-L-tyrosine alox5-fgr-1 2 Yes 7 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant enzyme enzyme neutral component neutral component purified purified 5-LO 4 ms participant Identification by mass spectrometry ms participant ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component purified purified photyr445 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain photyr53 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain photyr42 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation Table 2 P07947 is required for phosphorylation of P09917 P09917 Tyr-42, Tyr-53 and Tyr-445 O4'-phospho-L-tyrosine alox5-prkaca-1 1 CaMK II 6 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot enzyme enzyme neutral component neutral component purified purified 5-LO 4 ms participant Identification by mass spectrometry ms participant western blot western blot Immuno blot Immuno blot enzyme target enzyme target substrate substrate neutral component neutral component purified purified phoser523 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain phoser271 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation Fig. 3b After in-vitro kinase assay with CaMK II and 5-LO, gel based MS analysis failed to detect any phosphopeptide. However, this is in contrast with immunoblotting experiments which indicated phosphorylation of 5-LO at both Ser271 and Ser523 (Fig. 3). Q13555 is required for phosphorylation of P09917 P09917 Ser-271 and Ser-523 O-phospho-L-serine alox5-hck 3 5-LO 4 autoradiography autoradiography autoradiography autoradiography enzyme target enzyme target substrate substrate neutral component neutral component purified purified ecolx Escherichia coli HCK 5 autoradiography autoradiography autoradiography autoradiography enzyme enzyme neutral component neutral component purified purified phosphorylation phosphorylation reaction phosphorylation Fig. 5a alox5-hck-1 3 Yes 7 autoradiography autoradiography autoradiography autoradiography enzyme enzyme neutral component neutral component purified purified 5-LO 4 autoradiography autoradiography autoradiography autoradiography enzyme target enzyme target substrate substrate neutral component neutral component purified purified ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation Fig. 5b alox5-hck-2 3 Fgr 10 autoradiography autoradiography autoradiography autoradiography enzyme enzyme neutral component neutral component purified purified 5-LO 4 autoradiography autoradiography autoradiography autoradiography enzyme target enzyme target substrate substrate neutral component neutral component purified purified ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation Fig. 5c alox5-prkaca-2 1 PKA 9 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot enzyme enzyme neutral component neutral component purified purified 5-LO 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot enzyme target enzyme target substrate substrate neutral component neutral component purified purified phoser523 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain phoser271 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation Fig. 3a P09917 Ser-271 and Ser-523 O-phospho-L-serine