MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Activity of the Upstream TATA-less Promoter of the p21(Waf1/Cip1) Gene Depends on Transcription Factor IIA (TFIIA) in Addition to TFIIA-reactive TBP-like Protein (TLP). Activity of the Upstream TATA-less Promoter of the p21(Waf1/Cip1) Gene Depends on Transcription Factor IIA (TFIIA) in Addition to TFIIA-reactive TBP-like Protein (TLP). FEBS J. (1742-464X) 2014 imex curation Suzuki H., Maeda R., Nakadai T., Tamura T.A. ttamura@faculty.chiba-u.jp 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot ttamura@faculty.chiba-u.jp Accepted 2014-MAY-14 by LUANA 2014 imex curation Activity of the Upstream TATA-less Promoter of the p21(Waf1/Cip1) Gene Depends on Transcription Factor IIA (TFIIA) in Addition to TFIIA-reactive TBP-like Protein (TLP). Activity of the Upstream TATA-less Promoter of the p21(Waf1/Cip1) Gene Depends on Transcription Factor IIA (TFIIA) in Addition to TFIIA-reactive TBP-like Protein (TLP). FEBS J. (1742-464X) 2014 imex curation Suzuki H., Maeda R., Nakadai T., Tamura T.A. ttamura@faculty.chiba-u.jp 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot ttamura@faculty.chiba-u.jp Accepted 2014-MAY-14 by LUANA 2014 imex curation tf2aa_human Transcription initiation factor IIA subunit 1 GTF2A1 TF2A1 General transcription factor IIA subunit 1 Transcription initiation factor TFIIA 42 kDa subunit TFIIAL protein protein human Homo sapiens Human MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW DIP protein P52655 original sequence version: 168 4BAE1853E7E89218 tbpl1_mouse TATA box-binding protein-like 1 Tbpl1 Tlp Tlp21 Tlf Trf2 Trp TATA box-binding protein-related factor 2 TBP-like factor TBP-related protein 21 kDa TBP-like protein protein protein mouse Mus musculus Mouse MDADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATIWSSGKIICTGATSEEEAKFGARRLARSLQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEFTKNNRPHASYEPELHPAVCYRIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFESRKEIL Does not bind the TATA box. Has DNA-binding ability mint 2CDD9F5E7BDDE63F tbpl1_human TATA box-binding protein-like 1 TATA box-binding protein-related factor 2 TLF 21 kDa TBP-like protein TBPL1 TLP TLP21 TRF2 TRP TBP-related protein TBP-like factor Second TBP of unique DNA protein protein protein human Homo sapiens Human MDADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATIWSSGKIICTGATSEEEAKFGARRLARSLQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEFTKNNRPHASYEPELHPAVCYRIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFESRKEIL 2CDD9F5E7BDDE63F tbpl1-gtf2a1-2 1 TLP 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag/his tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P62340:p.Asn37Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain N E Wed May 02 14:40:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn37glu' Tue Jun 30 19:06:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn37Glu' TFIIA alpha 3 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain TFIIA beta 3 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain association association f1 In this study, we first investigated in detail the intracellular TFIIA-binding strength of those mutants by co-immunoprecipitation assays. It was confirmed that wild-type TLP and R55E exhibited significant binding to TFIIA, whereas N37E did not bind to TFIIA (Fig. 1). We further investigated processed and unprocessed forms of TFIIAα/β and found that R52E binds to the α and β subunits of TFIIA but does not bind to uncleaved TFIIAαβ (Fig. 1, lane 12). gtf2a1-tbpl1-1 2 TFIIA alpha/beta 3 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level TLP 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f6f We then examined effect of etoposide on TLP-TFIIA interaction. A co-immunoprecipitation experiment revealed that TLP and TFIIA form an intracellular complex in etoposide-treated cells upon DNA damage (Fig. 6F).