MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it SUMO-1 modification regulates ATRA-induced differentiation via stabilization of RARα SUMO-1 modification regulates ATRA-induced differentiation via stabilization of RARα FEBS J. (1742-464X) 2014 imex curation Zhou Q., Zhang L., Chen Z., Zhao P., Ma Y., Yang B., He Q., Ying M. Mying@zju.edu.cn 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions human-aml Human AML cells aml Acute myeloid leukemia cells fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Mying@zju.edu.cn Accepted 2014-MAY-09 by LUANA 2014 imex curation SUMO-1 modification regulates ATRA-induced differentiation via stabilization of RARα SUMO-1 modification regulates ATRA-induced differentiation via stabilization of RARα FEBS J. (1742-464X) 2014 imex curation Zhou Q., Zhang L., Chen Z., Zhao P., Ma Y., Yang B., He Q., Ying M. Mying@zju.edu.cn 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Mying@zju.edu.cn Accepted 2014-MAY-09 by LUANA 2014 imex curation SUMO-1 modification regulates ATRA-induced differentiation via stabilization of RARα SUMO-1 modification regulates ATRA-induced differentiation via stabilization of RARα FEBS J. (1742-464X) 2014 imex curation Zhou Q., Zhang L., Chen Z., Zhao P., Ma Y., Yang B., He Q., Ying M. Mying@zju.edu.cn 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions human-aml Human AML cells aml Acute myeloid leukemia cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mying@zju.edu.cn Accepted 2014-MAY-09 by LUANA 2014 imex curation SUMO-1 modification regulates ATRA-induced differentiation via stabilization of RARα SUMO-1 modification regulates ATRA-induced differentiation via stabilization of RARα FEBS J. (1742-464X) 2014 imex curation Zhou Q., Zhang L., Chen Z., Zhao P., Ma Y., Yang B., He Q., Ying M. Mying@zju.edu.cn 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mying@zju.edu.cn Accepted 2014-MAY-09 by LUANA 2014 imex curation rara_human Retinoic acid receptor alpha RARA NR1B1 Nuclear receptor subfamily 1 group B member 1 protein protein human Homo sapiens Human MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP DIP protein P10276 original sequence version: 190 DIP protein P10276 original sequence version: 118 DIP protein P10276 original sequence version: 162 DIP protein P10276-1 original sequence version: 143 DIP protein P10276 original sequence version: 200 DIP protein P10276-1 original sequence version: 152 E8D1CF9A1E57CB99 sumo1_human Small ubiquitin-related modifier 1 SUMO1 Sentrin Ubiquitin-like protein SMT3C Ubiquitin-homology domain protein PIC1 Ubiquitin-like protein UBL1 GAP-modifying protein 1 SMT3 homolog 3 SMT3C SMT3H3 UBL1 OK/SW-cl.43 protein protein human Homo sapiens Human MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV DIP protein P63165 original sequence version: 36 DIP protein P63165 original sequence version: 40 DIP protein P63165 original sequence version: 124 DIP protein P63165 original sequence version: 125 DIP protein P63165 original sequence version: 83 DIP protein P63165 original sequence version: 85 DIP protein P63165 original sequence version: 81 DIP protein P63165 original sequence version: 84 DIP protein P63165 original sequence version: 103 DIP protein P63165 original sequence version: 100 DIP protein P63165 original sequence version: 95 DIP protein P63165 original sequence version: 98 DIP protein P63165 original sequence version: 101 DIP protein P63165-1 original sequence version: 131 DIP protein P63165 original sequence version: 102 DIP protein P63165 original sequence version: 122 DIP protein P63165 original sequence version: 62 DIP protein P63165 original sequence version: 119 DIP protein P63165 original sequence version: 82 89BE97D2D054FB33 rara-sumo1 1 RAR-alpha 5 immunostaining immunostaining immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell SUMO1 6 immunostaining immunostaining immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f4a we first assessed whether endogenous SUMO-1 interacts with endogenous RARα in U2OS, HL60, and NB4 cells using immunofluorescence analysis. As presented in Fig.4A, our results demonstrated that SUMO-1 (red) and RARα (green) localized in cells as clearly displayed in the merged immunofluorescence images (yellow), indicating a potential interaction between RARα and SUMO-1. rara-sumo1-2 3 SUMO1 6 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level RAR-alpha 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f4b F4G To further determine whether RARα can be modified by SUMO-1, we performed a reciprocal immunoprecipitation assay in U2OS, HL60, and NB4 cells. As expected, immunoprecipitation of RARα resulted in the isolation of SUMO-1, while immunoprecipitation of SUMO-1 conversely identified RARα (Fig.4B). rara-sumo1-3 3 RAR-alpha 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level SUMO1 6 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f4b To further determine whether RARα can be modified by SUMO-1, we performed a reciprocal immunoprecipitation assay in U2OS, HL60, and NB4 cells. As expected, immunoprecipitation of RARα resulted in the isolation of SUMO-1, while immunoprecipitation of SUMO-1 conversely identified RARα (Fig.4B). sumo1-rara 2 SUMO-1 6 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RAR-alpha 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P10276:p.Lys399Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K R Wed May 02 16:10:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys399arg' Tue Jun 30 17:29:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys399Arg' physical association physical association f4c f5c rara-sumo1-4 4 SUMO-1 6 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RAR-alpha 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P10276:p.Lys399Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K R Wed May 02 14:24:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys399arg' Tue Jun 30 20:14:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys399Arg' physical association physical association f5b