MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it FIP5 phosphorylation during mitosis regulates apical trafficking and lumenogenesis. FIP5 phosphorylation during mitosis regulates apical trafficking and lumenogenesis. EMBO Rep. (1469-221X) 2014 imex curation Li D., Mangan A., Cicchini L., Margolis B., Prekeris R. Rytis.Prekeris@ucdenver.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Li D., Mangan A., Cicchini L., Margolis B., Prekeris R. Rytis.Prekeris@ucdenver.edu Accepted 2014-DEC-09 by MARTA EMBO Rep. (1469-221X) 2014 Only protein-protein interactions imex curation FIP5 phosphorylation during mitosis regulates apical trafficking and lumenogenesis. FIP5 phosphorylation during mitosis regulates apical trafficking and lumenogenesis. EMBO Rep. (1469-221X) 2014 imex curation Li D., Mangan A., Cicchini L., Margolis B., Prekeris R. Rytis.Prekeris@ucdenver.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Li D., Mangan A., Cicchini L., Margolis B., Prekeris R. Rytis.Prekeris@ucdenver.edu Accepted 2014-DEC-09 by MARTA EMBO Rep. (1469-221X) 2014 Only protein-protein interactions imex curation FIP5 phosphorylation during mitosis regulates apical trafficking and lumenogenesis. FIP5 phosphorylation during mitosis regulates apical trafficking and lumenogenesis. EMBO Rep. (1469-221X) 2014 imex curation Li D., Mangan A., Cicchini L., Margolis B., Prekeris R. Rytis.Prekeris@ucdenver.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line imaging technique imaging technique microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Li D., Mangan A., Cicchini L., Margolis B., Prekeris R. Rytis.Prekeris@ucdenver.edu Accepted 2014-DEC-09 by MARTA EMBO Rep. (1469-221X) 2014 Only protein-protein interactions imex curation FIP5 phosphorylation during mitosis regulates apical trafficking and lumenogenesis. FIP5 phosphorylation during mitosis regulates apical trafficking and lumenogenesis. EMBO Rep. (1469-221X) 2014 imex curation Li D., Mangan A., Cicchini L., Margolis B., Prekeris R. Rytis.Prekeris@ucdenver.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Li D., Mangan A., Cicchini L., Margolis B., Prekeris R. Rytis.Prekeris@ucdenver.edu Accepted 2014-DEC-09 by MARTA EMBO Rep. (1469-221X) 2014 Only protein-protein interactions imex curation g1t8e2_rabit Glycogen synthase kinase-3 beta GSK3B protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKDSSGTGRFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDGLFNEQFFALNSKGQISSLI Similar to P49841 1F32A12644F1DB3E rfip3_human Rab11 family-interacting protein 3 RAB11FIP3 KIAA0665 EF hands-containing Rab-interacting protein ARFO1 Arfophilin-1 MU-MB-17.148 protein protein human Homo sapiens Human MASAPPASPPGSEPPGPDPEPGGPDGPGAAQLAPGPAELRLGAPVGGPDPQSPGLDEPAPGAAADGGARWSAGPAPGLEGGPRDPGPSAPPPRSGPRGQLASPDAPGPGPRSEAPLPELDPLFSWTEEPEECGPASCPESAPFRLQGSSSSHRARGEVDVFSPFPAPTAGELALEQGPGSPPQPSDLSQTHPLPSEPVGSQEDGPRLRAVFDALDGDGDGFVRIEDFIQFATVYGAEQVKDLTKYLDPSGLGVISFEDFYQGITAIRNGDPDGQCYGGVASAQDEEPLACPDEFDDFVTYEANEVTDSAYMGSESTYSECETFTDEDTSTLVHPELQPEGDADSAGGSAVPSECLDAMEEPDHGALLLLPGRPHPHGQSVITVIGGEEHFEDYGEGSEAELSPETLCNGQLGCSDPAFLTPSPTKRLSSKKVARYLHQSGALTMEALEDPSPELMEGPEEDIADKVVFLERRVLELEKDTAATGEQHSRLRQENLQLVHRANALEEQLKEQELRACEMVLEETRRQKELLCKMEREKSIEIENLQTRLQQLDEENSELRSCTPCLKANIERLEEEKQKLLDEIESLTLRLSEEQENKRRMGDRLSHERHQFQRDKEATQELIEDLRKQLEHLQLLKLEAEQRRGRSSSMGLQEYHSRARESELEQEVRRLKQDNRNLKEQNEELNGQIITLSIQGAKSLFSTAFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAIMETNPSILEVK mint 264CEC399F28AFB9 rfip5_human Rab11 family-interacting protein 5 RAB11FIP5 GAF1 KIAA0857 RIP11 Rab11-interacting protein Rip11 Gamma-SNAP-associated factor 1 Phosphoprotein pp75 protein protein human Homo sapiens Human MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQVGREKYSTSVVEKTHGCPEWREECSFELPPGALDGLLRAQEADAGPAPWAASSAAACELVLTTMHRSLIGVDKFLGQATVALDEVFGAGRAQHTQWYKLHSKPGKKEKERGEIEVTIQFTRNNLSASMFDLSMKDKPRSPFSKIRDKMKGKKKYDLESASAILPSSAIEDPDLGSLGKMGKAKGFFLRNKLRKSSLTQSNTSLGSDSTLSSASGSLAYQGPGAELLTRSPSRSSWLSTEGGRDSAQSPKLFTHKRTYSDEANQMRVAPPRALLDLQGHLDAASRSSLCVNGSHIYNEEPQGPVRHRSSISGSLPSSGSLQAVSSRFSEEGPRSTDDTWPRGSRSNSSSEAVLGQEELSAQAKVLAPGASHPGEEEGARLPEGKPVQVATPIVASSEAVAEKEGARKEERKPRMGLFHHHHQGLSRSELGRRSSLGEKGGPILGASPHHSSSGEEKAKSSWFGLREAKDPTQKPSPHPVKPLSAAPVEGSPDRKQSRSSLSIALSSGLEKLKTVTSGSIQPVTQAPQAGQMVDTKRLKDSAVLDQSAKYYHLTHDELISLLLQRERELSQRDEHVQELESYIDRLLVRIMETSPTLLQIPPGPPK 716725537AA9D86E e2rgw4_canlf Syntaxin-18 STX18 protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MAVDITLLFRASVKTVKTRNKALGVAVGGGGVDGSRDELFRRSPRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHIMSEYGRMTDTERDQIDQDAQTFMRTCSEAIQQLRTQAHKEIHSQQVKEHRSAVLDFIEDYLKRVCKLYSEQRAIRVKRVVDKKRLSKLEPEPHTKTRESTSSEKVSQTPSQESEEKPVTEECPEKIPAESQPELGTWGDGKGDDELSPEEIQMFEQENQRLIGEMNSLFDEVRQIEGRVVEISRLQEIFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNNAGFRVWVLFFLVMCSFSLLFLD AA6BDEC3ECB7F167 rb11a_human Ras-related protein Rab-11A YL8 RAB11A RAB11 protein protein human Homo sapiens Human MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI DIP protein P62491 original sequence version: 38 DIP protein P62491-1 original sequence version: 132 DIP protein P62491 original sequence version: 122 DIP protein P62491 original sequence version: 89 DIP protein P62491-1 original sequence version: 137 DIP protein P62491 original sequence version: 136 DIP protein P62491 original sequence version: 137 DIP protein P62491-1 original sequence version: 140 76FC1E113A29B269 crum3_human Protein crumbs homolog 3 CRB3 UNQ588/PRO1158 protein protein human Homo sapiens Human MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAIIVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQVGARVPPTPNLKLPPEERLI F0CCDE3D91E7392D kif3a_human Kinesin-like protein KIF3A KIF3A KIF3 Microtubule plus end-directed kinesin motor 3A protein protein human Homo sapiens Human MPINKSEKPESCDNVKVVVRCRPLNEREKSMCYKQAVSVDEMRGTITVHKTDSSNEPPKTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAIPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGIDGNMHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKKKLEEGEEISGSDISGSEEDDDEEGEVGEDGEKRKKRRGKKKVSPDKMIEMQAKIDEERKALETKLDMEEEERNKARAELEKREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNMELEERRKRAEQLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIPRDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRKQTPVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGRRKRSAKPETVIDSLLQ DIP protein Q9Y496 original sequence version: 79 A0BF5BB1F699DF12 snx18_human Sorting nexin-18 SNX18 SH3 and PX domain-containing protein 3B SH3PXD3B protein protein human Homo sapiens Human MALRARALYDFRSENPGEISLREHEVLSLCSEQDIEGWLEGVNSRGDRGLFPASYVQVIRAPEPGPAGDGGPGAPARYANVPPGGFEPLPVAPPASFKPPPDAFQALLQPQQAPPPSTFQPPGAGFPYGGGALQPSPQQLYGGYQASQGSDDDWDDEWDDSSTVADEPGALGSGAYPDLDGSSSAGVGAAGRYRLSTRSDLSLGSRGGSVPPQHHPSGPKSSATVSRNLNRFSTFVKSGGEAFVLGEASGFVKDGDKLCVVLGPYGPEWQENPYPFQCTIDDPTKQTKFKGMKSYISYKLVPTHTQVPVHRRYKHFDWLYARLAEKFPVISVPHLPEKQATGRFEEDFISKRRKGLIWWMNHMASHPVLAQCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFLTLSTPPAAALDLQEVESKIDGFKCFTKKMDDSALQLNHTANEFARKQVTGFKKEYQKVGQSFRGLSQAFELDQQAFSVGLNQAIAFTGDAYDAIGELFAEQPRQDLDPVMDLLALYQGHLANFPDIIHVQKGKAWPLEQVIWSVLCRLKGATLTAVPLWVSESYSTGEEASRDVDAWVFSLECKLDCSTGSFLLEYLALGNEYSFSKVQRVPLMTVLSF BE7B16835BA80F9C rab11fip3-rab11fip5 3 6 tag fluorescence tag visualisation by fluorescence tag fluorescence tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 tag fluorescence tag visualisation by fluorescence tag fluorescence tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell rfp tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization sf1 To test whether FIP5-endosomes are targeted to the midbody, we used FIP3 as a marker known to be present on recycling endosomes at the central spindle and midbody [7,8]. FIP5 co-localized with FIP3 and the apical marker Crb3a at telophase (Supplementary Fig S1A–D), suggesting that FIP5-endo- somes deliver apical proteins along central spindle microtubules to the midbody. rab11fip3-rab11fip5-1 3 10 tag fluorescence tag visualisation by fluorescence tag fluorescence tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 tag fluorescence tag visualisation by fluorescence tag fluorescence tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell rfp tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization sf1 To test whether FIP5-endosomes are targeted to the midbody, we used FIP3 as a marker known to be present on recycling endosomes at the central spindle and midbody [7,8]. FIP5 co-localized with FIP3 and the apical marker Crb3a at telophase (Supplementary Fig S1A–D), suggesting that FIP5-endo- somes deliver apical proteins along central spindle microtubules to the midbody. gsk3b-rab11fip5 1 5 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot enzyme enzyme neutral component neutral component purified purified 7 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot enzyme target enzyme target substrate substrate neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined thr276 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain phosphorylation phosphorylation reaction phosphorylation f2b rab11a-rab11fip5 2 7 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2c rab11a-rab11fip5-1 2 7 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate Q9BXF6:p.Thr276Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T D Wed May 02 16:45:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr276asp' Tue Jun 30 18:57:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr276Asp' gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2c snx18-rab11fip5 2 12 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate Q9BXF6:p.Thr276Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain T A Wed May 02 17:51:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr276ala' Tue Jun 30 17:18:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr276Ala' gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2c snx18-rab11fip5-1 2 11 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate Q9BXF6:p.Thr276Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain T A Wed May 02 17:00:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr276ala' Tue Jun 30 17:13:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr276Ala' gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2c kif3a-rab11fip5 2 7 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate Q9BXF6:p.Thr276Asp mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain T D Wed May 02 17:48:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr276asp' Tue Jun 30 16:22:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr276Asp' gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2c snx18-rab11fip5-2 2 7 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f2e rab11fip5-stx18 4 7 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q9BXF6:p.Thr276Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T D Wed May 02 19:29:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr276asp' Tue Jun 30 16:42:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr276Asp' gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f2f