IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Phosphorylation of Grb14 BPS domain by GSK-3 correlates with complex forming of Grb14 and insulin receptor. Phosphorylation of Grb14 BPS domain by GSK-3 correlates with complex forming of Grb14 and insulin receptor. J. Biochem. (0021-924X) 2014 imex curation Taira J., Higashimoto Y. Diabetes - Interactions investigated in the context of Diabetes Affinomics - Interactions curated for the Affinomics consortium. taira_junichi@med.kurume-u.ac.jp 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Taira J., Higashimoto Y. Diabetes - Interactions investigated in the context of Diabetes Kinase-Glo Luminescent Kinase Assay (Promega);quantitating the amount of ATP remaining in solution following a kinase reaction. The luminescent signal is correlated with the amount of ATP present and is inversely correlated with the amount of kinase activity. IR cDNA is supplied by Kazusa DNA Research Institute (pFN21AE3464). The ORF corresponds to a protein of 1370aa, corresponding to Uniprot ID P06213-2 . GRB14 cDNA, protein_id="BAG35971.1" has 99% homology to the sequence given in the reviewed UniProt entry ID= Q14449. Recombinant GSK-3 supplied by New England Biolabs is Rabbit GSK3-beta derived from a Rabbit skeletal muscle cDNA library. (see pmid: 7514173) taira_junichi@med.kurume-u.ac.jp Accepted 2014-NOV-27 by ORCHARD J. Biochem. (0021-924X) 2014 Only protein-protein interactions imex curation Phosphorylation of Grb14 BPS domain by GSK-3 correlates with complex forming of Grb14 and insulin receptor. Phosphorylation of Grb14 BPS domain by GSK-3 correlates with complex forming of Grb14 and insulin receptor. J. Biochem. (0021-924X) 2014 imex curation Taira J., Higashimoto Y. Diabetes - Interactions investigated in the context of Diabetes Affinomics - Interactions curated for the Affinomics consortium. taira_junichi@med.kurume-u.ac.jp 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay ms participant Identification by mass spectrometry ms participant Taira J., Higashimoto Y. Diabetes - Interactions investigated in the context of Diabetes Kinase-Glo Luminescent Kinase Assay (Promega);quantitating the amount of ATP remaining in solution following a kinase reaction. The luminescent signal is correlated with the amount of ATP present and is inversely correlated with the amount of kinase activity. IR cDNA is supplied by Kazusa DNA Research Institute (pFN21AE3464). The ORF corresponds to a protein of 1370aa, corresponding to Uniprot ID P06213-2 . GRB14 cDNA, protein_id="BAG35971.1" has 99% homology to the sequence given in the reviewed UniProt entry ID= Q14449. Recombinant GSK-3 supplied by New England Biolabs is Rabbit GSK3-beta derived from a Rabbit skeletal muscle cDNA library. (see pmid: 7514173) taira_junichi@med.kurume-u.ac.jp Accepted 2014-NOV-27 by ORCHARD J. Biochem. (0021-924X) 2014 Only protein-protein interactions imex curation Phosphorylation of Grb14 BPS domain by GSK-3 correlates with complex forming of Grb14 and insulin receptor. Phosphorylation of Grb14 BPS domain by GSK-3 correlates with complex forming of Grb14 and insulin receptor. J. Biochem. (0021-924X) 2014 imex curation Taira J., Higashimoto Y. Diabetes - Interactions investigated in the context of Diabetes Affinomics - Interactions curated for the Affinomics consortium. taira_junichi@med.kurume-u.ac.jp 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Taira J., Higashimoto Y. Diabetes - Interactions investigated in the context of Diabetes IR cDNA is supplied by Kazusa DNA Research Institute (pFN21AE3464). The ORF corresponds to a protein of 1370aa, corresponding to Uniprot ID P06213-2 . GRB14 cDNA, protein_id="BAG35971.1" has 99% homology to the reviewed UniProt entry ID= Q14449. taira_junichi@med.kurume-u.ac.jp Accepted 2014-NOV-27 by ORCHARD J. Biochem. (0021-924X) 2014 Only protein-protein interactions imex curation Phosphorylation of Grb14 BPS domain by GSK-3 correlates with complex forming of Grb14 and insulin receptor. Phosphorylation of Grb14 BPS domain by GSK-3 correlates with complex forming of Grb14 and insulin receptor. J. Biochem. (0021-924X) 2014 imex curation Taira J., Higashimoto Y. Diabetes - Interactions investigated in the context of Diabetes Affinomics - Interactions curated for the Affinomics consortium. taira_junichi@med.kurume-u.ac.jp 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Taira J., Higashimoto Y. Diabetes - Interactions investigated in the context of Diabetes taira_junichi@med.kurume-u.ac.jp Accepted 2014-NOV-27 by ORCHARD J. Biochem. (0021-924X) 2014 Only protein-protein interactions imex curation p06213-2 Insulin receptor HIR-A INSR protein protein human Homo sapiens Human MATGGRRGAAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRPSRKRRSLGDVGNVTVAVPTVAAFPNTSSTSVPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCRLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS DIP protein P06213-2 original sequence version: 186 A396F39279C2764D gsk3b_human Glycogen synthase kinase-3 beta GSK3B Serine/threonine-protein kinase GSK3B protein protein human Homo sapiens Human MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST DIP protein P49841 original sequence version: 109 DIP protein P49841 original sequence version: 136 DIP protein P49841 original sequence version: 143 DIP protein P49841 original sequence version: 141 DIP protein P49841 original sequence version: 196 DIP protein P49841 original sequence version: 159 DIP protein P49841 original sequence version: 151 4ACC24D00CDBB9C3 csk2b_human Casein kinase II subunit beta Phosvitin Protein G5a CSNK2B CK2N G5A protein protein human Homo sapiens Human MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR DIP protein P67870 original sequence version: 77 DIP protein P67870 original sequence version: 124 DIP protein P67870 original sequence version: 134 E465B1E699B0E0EC grb14_human Growth factor receptor-bound protein 14 GRB14 adapter protein GRB14 protein protein human Homo sapiens Human MTTSLQDGQSAASRAAARDSPLAAQVCGAAQGRGDAHDLAPAPWLHARALLPLPDGTRGCAADRRKKKDLDVPEMPSIPNPFPELCCSPFTSVLSADLFPKANSRKKQVIKVYSEDETSRALDVPSDITARDVCQLLILKNHYIDDHSWTLFEHLPHIGVERTIEDHELVIEVLSNWGIEEENKLYFRKNYAKYEFFKNPMYFFPEHMVSFATETNGEISPTQILQMFLSSSTYPEIHGFLHAKEQGKKSWKKIYFFLRRSGLYFSTKGTSKEPRHLQFFSEFGNSDIYVSLAGKKKHGAPTNYGFCFKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNYMHPYQGRSGCSSQSISPMRSISENSLVAMDFSGQKSRVIENPTEALSVAVEEGLAWRKKGCLRLGTHGSPTASSQSSATNMAIHRSQPWFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMSHGQKIKHFQIIPVEDDGEMFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCARIAL DIP protein Q14449 original sequence version: 94 00472988650F7C6C csk21_human Casein kinase II subunit alpha CSNK2A1 CK2A1 protein protein human Homo sapiens Human MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPTPSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ DIP protein P68400 original sequence version: 88 DIP protein P68400 original sequence version: 78 DIP protein P68400 original sequence version: 100 DIP protein P68400 original sequence version: 110 DIP protein P68400 original sequence version: 125 DIP protein P68400 original sequence version: 136 D3B6F5D13FF7422D rabbit_gsk3_beta RABBIT GSK3-BETA protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit grb14-gsk3b 4 6 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction 2A A robust signal was obtained using transfected Human Grb14 and GSK-3beta; however endogenous Grb14, GSK-3alpha and GSK-3beta were also detected. grb14-insr-1 3 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait Q14449:p.[Ser358Ala;Ser362Ala;Ser366Ala] mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A Wed May 02 19:30:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser358ala,ser362ala,ser366ala' Tue Jun 30 18:47:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser358Ala;Ser362Ala;Ser366Ala]' c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 3/4/6 Insulin GSK-3 inhibitor IX GSK-3 knockdown insr-csnk2a1 1 9 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate neutral component neutral component bps_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role ancillary ancillary ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 5A Recombinant Rabbit GSK-3beta Q14449 O-phospho-L-serine grb14-rabbit 2 10 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate neutral component neutral component required_phosphoser_370 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain bps_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) phosphorylation phosphorylation reaction phosphorylation 5A Q14449 opser After GSK-3 incubation using the Ser370 phosphorylated peptide Grb14(355–375) signals corresponding to bi-, tri- and tetra-phosphorylated peptides were found; using the non-phosphorylated peptide a signal corresponded to a non-phosphorylated peptide was found, with a marginal signal indicating mono-phosphorylated peptides. cannot enter more than "opser" for the res-ptm as there are also several serines other than those mentioned in the text, and no indication which ones exactly are phosph-ed.