MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Interaction between nucleophosmin and HBV core protein increases HBV capsid assembly. Interaction between nucleophosmin and HBV core protein increases HBV capsid assembly. FEBS Lett. (0014-5793) 2014 imex curation Jeong H., Cho M.H., Park S.G., Jung G. drjung@snu.ac.kr 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot drjung@snu.ac.kr Accepted 2014-JAN-13 by LUANA 2014 imex curation Interaction between nucleophosmin and HBV core protein increases HBV capsid assembly. Interaction between nucleophosmin and HBV core protein increases HBV capsid assembly. FEBS Lett. (0014-5793) 2014 imex curation Jeong H., Cho M.H., Park S.G., Jung G. drjung@snu.ac.kr 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro bn-page blue native page bn-page western blot western blot Immuno blot Immuno blot drjung@snu.ac.kr Accepted 2014-JAN-13 by LUANA 2014 imex curation Interaction between nucleophosmin and HBV core protein increases HBV capsid assembly. Interaction between nucleophosmin and HBV core protein increases HBV capsid assembly. FEBS Lett. (0014-5793) 2014 imex curation Jeong H., Cho M.H., Park S.G., Jung G. drjung@snu.ac.kr 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot drjung@snu.ac.kr Accepted 2014-JAN-13 by LUANA 2014 imex curation b1q2w9_hbvdr Capsid protein Core antigen Core protein HBcAg p21.5 C pre-C/C protein protein hbvdr Hepatitis B virus subtype adr MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC DEF512E3B3DA118D npm_human Nucleophosmin NPM1 NPM Nucleolar phosphoprotein B23 Numatrin Nucleolar protein NO38 protein protein human Homo sapiens Human MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL 620BC7BA2E4A0054 npm1-pre_c_c 1 B23 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified Cp149 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain undefined mutation W125K mutation disrupting mutation disrupting interaction mutation disrupting undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f1b npm1-pre_c_c-1 1 B23 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified Cp149 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain undefined mutation W125L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Wed May 02 16:02:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys125leu' direct interaction direct interaction f1b npm1-pre_c_c-2 1 B23 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified Cp149 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified undefined mutation W125E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Wed May 02 18:30:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys125glu' binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f1b pre_c_c-npm1 1 B23 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified P06748:p.Asp286Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A Wed May 02 18:12:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp286ala' Tue Jun 30 15:51:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp286Ala' Cp149 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f1c npm1-pre_c_c-3 3 B23 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified P06748:p.Asp286Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D A Wed May 02 17:17:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp286ala' Tue Jun 30 15:38:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp286Ala' Cp149 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified undefined mutation W125K mutation disrupting mutation disrupting interaction mutation disrupting undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f1d npm1-pre_c_c-4 3 Cp149 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain B23 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified colocalization colocalization f2b pre_c_c-npm1-1 1 Cp149 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain B23 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified P06748:p.Cys21Phe mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain C F Wed May 02 15:07:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys21phe' Tue Jun 30 16:07:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys21Phe' physical association physical association f4a f4b we used co11 immunoprecipitation analysis to examine whether oligomerization of B23 was necessary for its interaction with core protein. Given that the B23 mutant C21F is defective in oligomerization [19], C21F was used as a monomer in this analysis. The HBV core dimer could interact only with B23 oligomer but not with B23 monomer (Fig. 4A). These showed that the oligomerization of B23 was mandatory for its interaction with core protein. Consistent with the data, C21F (a monomeric form of B23) could not promote capsid assembly (Fig. 4B). npm1-pre_c_c-5 1 B23 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified P06748:p.Cys21Phe mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain C F Wed May 02 16:46:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys21phe' Tue Jun 30 19:12:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys21Phe' Cp149 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f4a f4b we used co11 immunoprecipitation analysis to examine whether oligomerization of B23 was necessary for its interaction with core protein. Given that the B23 mutant C21F is defective in oligomerization [19], C21F was used as a monomer in this analysis. The HBV core dimer could interact only with B23 oligomer but not with B23 monomer (Fig. 4A). These showed that the oligomerization of B23 was mandatory for its interaction with core protein. Consistent with the data, C21F (a monomeric form of B23) could not promote capsid assembly (Fig. 4B). npm1-npm1 2 B23 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified B23 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction sf1d