IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton. The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton. Cell (0092-8674) 2014 imex curation Chen B., Brinkmann K., Chen Z., Pak C.W., Liao Y., Shi S., Henry L., Grishin N.V., Bogdan S., Rosen M.K. sbogdan@uni-muenster.de, michael.rosen@utsouthwestern.edu 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Chen B., Brinkmann K., Chen Z., Pak C.W., Liao Y., Shi S., Henry L., Grishin N.V., Bogdan S., Rosen M.K. sbogdan@uni-muenster.de, michael.rosen@utsouthwestern.edu Accepted 2014-FEB-28 by PPORRAS Cell (0092-8674) 2014 Only protein-protein interactions imex curation The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton. The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton. Cell (0092-8674) 2014 imex curation Chen B., Brinkmann K., Chen Z., Pak C.W., Liao Y., Shi S., Henry L., Grishin N.V., Bogdan S., Rosen M.K. sbogdan@uni-muenster.de, michael.rosen@utsouthwestern.edu 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chen B., Brinkmann K., Chen Z., Pak C.W., Liao Y., Shi S., Henry L., Grishin N.V., Bogdan S., Rosen M.K. His-tagged Sra1 (1–1253) and Nap1 (1–1128) were separately overexpressed in sf9 cells and Hi5 cells, respectively. Cells were lysed together and the Sra1:Nap1 complex was partially purified by a Ni-affinity column.WAVE1–178 , Abi2 (1–158) and full-length HSPC300 were expressed separately in Escherichia coli as MBP-fusion proteins, purified with amylose-affinity chromatography and assembled into the trimer subcomplex by incubation in the presence of 1% NP-40 (Sigma) for 48 h. The trimer was isolated using Source 15Q chromatography, and then mixed with the Sra1:Nap1 dimer at a 1:1.5 molar ratio overnight on ice to form the pentameric complex. Excess Sra1:Nap1 dimer was removed by an amylose-affinity column. The eluted complex was further purified using Mono Q chromatography. The fusion tags were removed by treatment with TEV protease at room temperature for 4–6 h. The sample was brought to homogeneity by a Superdex200 column sbogdan@uni-muenster.de, michael.rosen@utsouthwestern.edu Accepted 2014-FEB-28 by PPORRAS Cell (0092-8674) 2014 Only protein-protein interactions imex curation The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton. The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton. Cell (0092-8674) 2014 imex curation Chen B., Brinkmann K., Chen Z., Pak C.W., Liao Y., Shi S., Henry L., Grishin N.V., Bogdan S., Rosen M.K. sbogdan@uni-muenster.de, michael.rosen@utsouthwestern.edu 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Chen B., Brinkmann K., Chen Z., Pak C.W., Liao Y., Shi S., Henry L., Grishin N.V., Bogdan S., Rosen M.K. His-tagged Sra1 (1–1253) and Nap1 (1–1128) were separately overexpressed in sf9 cells and Hi5 cells, respectively. Cells were lysed together and the Sra1:Nap1 complex was partially purified by a Ni-affinity column.WAVE1–178 , Abi2 (1–158) and full-length HSPC300 were expressed separately in Escherichia coli as MBP-fusion proteins, purified with amylose-affinity chromatography and assembled into the trimer subcomplex by incubation in the presence of 1% NP-40 (Sigma) for 48 h. The trimer was isolated using Source 15Q chromatography, and then mixed with the Sra1:Nap1 dimer at a 1:1.5 molar ratio overnight on ice to form the pentameric complex. Excess Sra1:Nap1 dimer was removed by an amylose-affinity column. The eluted complex was further purified using Mono Q chromatography. The fusion tags were removed by treatment with TEV protease at room temperature for 4–6 h. The sample was brought to homogeneity by a Superdex200 column sbogdan@uni-muenster.de, michael.rosen@utsouthwestern.edu Accepted 2014-FEB-28 by PPORRAS Cell (0092-8674) 2014 Only protein-protein interactions imex curation The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton. The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton. Cell (0092-8674) 2014 imex curation Chen B., Brinkmann K., Chen Z., Pak C.W., Liao Y., Shi S., Henry L., Grishin N.V., Bogdan S., Rosen M.K. sbogdan@uni-muenster.de, michael.rosen@utsouthwestern.edu 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Chen B., Brinkmann K., Chen Z., Pak C.W., Liao Y., Shi S., Henry L., Grishin N.V., Bogdan S., Rosen M.K. peptide sequence conserved in human/mouse so have invoked the match the peptide to everything else in the assay rule. sbogdan@uni-muenster.de, michael.rosen@utsouthwestern.edu Accepted 2014-FEB-28 by PPORRAS Cell (0092-8674) 2014 Only protein-protein interactions imex curation The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton. The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton. Cell (0092-8674) 2014 imex curation Chen B., Brinkmann K., Chen Z., Pak C.W., Liao Y., Shi S., Henry L., Grishin N.V., Bogdan S., Rosen M.K. sbogdan@uni-muenster.de, michael.rosen@utsouthwestern.edu 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen B., Brinkmann K., Chen Z., Pak C.W., Liao Y., Shi S., Henry L., Grishin N.V., Bogdan S., Rosen M.K. Not sure if the competing WIRS GST fusion was human or mouse so have only added as a comment. sbogdan@uni-muenster.de, michael.rosen@utsouthwestern.edu Accepted 2014-FEB-28 by PPORRAS Cell (0092-8674) 2014 Only protein-protein interactions imex curation The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton. The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton. Cell (0092-8674) 2014 imex curation Chen B., Brinkmann K., Chen Z., Pak C.W., Liao Y., Shi S., Henry L., Grishin N.V., Bogdan S., Rosen M.K. sbogdan@uni-muenster.de, michael.rosen@utsouthwestern.edu 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps tag fluorescence tag visualisation by fluorescence tag fluorescence Chen B., Brinkmann K., Chen Z., Pak C.W., Liao Y., Shi S., Henry L., Grishin N.V., Bogdan S., Rosen M.K. His-tagged Sra1 (1–1253) and Nap1 (1–1128) were separately overexpressed in sf9 cells and Hi5 cells, respectively. Cells were lysed together and the Sra1:Nap1 complex was partially purified by a Ni-affinity column.WAVE1–178 , Abi2 (1–158) and full-length HSPC300 were expressed separately in Escherichia coli as MBP-fusion proteins, purified with amylose-affinity chromatography and assembled into the trimer subcomplex by incubation in the presence of 1% NP-40 (Sigma) for 48 h. The trimer was isolated using Source 15Q chromatography, and then mixed with the Sra1:Nap1 dimer at a 1:1.5 molar ratio overnight on ice to form the pentameric complex. Excess Sra1:Nap1 dimer was removed by an amylose-affinity column. The eluted complex was further purified using Mono Q chromatography. The fusion tags were removed by treatment with TEV protease at room temperature for 4–6 h. The sample was brought to homogeneity by a Superdex200 column sbogdan@uni-muenster.de, michael.rosen@utsouthwestern.edu Accepted 2014-FEB-28 by PPORRAS Cell (0092-8674) 2014 Only protein-protein interactions imex curation The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton. The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton. Cell (0092-8674) 2014 imex curation Chen B., Brinkmann K., Chen Z., Pak C.W., Liao Y., Shi S., Henry L., Grishin N.V., Bogdan S., Rosen M.K. sbogdan@uni-muenster.de, michael.rosen@utsouthwestern.edu 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Chen B., Brinkmann K., Chen Z., Pak C.W., Liao Y., Shi S., Henry L., Grishin N.V., Bogdan S., Rosen M.K. His-tagged Sra1 (1–1253) and Nap1 (1–1128) were separately overexpressed in sf9 cells and Hi5 cells, respectively. Cells were lysed together and the Sra1:Nap1 complex was partially purified by a Ni-affinity column.WAVE1–178 , Abi2 (1–158) and full-length HSPC300 were expressed separately in Escherichia coli as MBP-fusion proteins, purified with amylose-affinity chromatography and assembled into the trimer subcomplex by incubation in the presence of 1% NP-40 (Sigma) for 48 h. The trimer was isolated using Source 15Q chromatography, and then mixed with the Sra1:Nap1 dimer at a 1:1.5 molar ratio overnight on ice to form the pentameric complex. Excess Sra1:Nap1 dimer was removed by an amylose-affinity column. The eluted complex was further purified using Mono Q chromatography. The fusion tags were removed by treatment with TEV protease at room temperature for 4–6 h. The sample was brought to homogeneity by a Superdex200 column sbogdan@uni-muenster.de, michael.rosen@utsouthwestern.edu Accepted 2014-FEB-28 by PPORRAS Cell (0092-8674) 2014 Only protein-protein interactions imex curation q8mlq0_drome HSPC300 SIP1-RA dHSPC300 CG30173 Dmel_CG30173 Dmel\CG30173 SIP1 dHSPC Brk1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSGAHREAIQKQIHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAVLNEKLTILERRIDYLEACVAQGETLT DIP protein Q8MLQ0 original sequence version: 55 59947DEC8E05437A q80te2_mouse Pcdh10 mKIAA1400 protein protein mouse Mus musculus Mouse NEAKGIKILIQPQEPPPHAAHFYLYFLDYYYSFCGGGWGAVIGVAGWLQGSCFLFLLEMIVLLFFALLWMVDGVFSQLHYTVQEEQEHGTFVGNIAEDLGLDITKLSARRFQTVANSRTPYLDLNLETGVLYVNEKIDREQICKQSPSCVLHLEVFLENPLELFRVEIEVLDINDNPPSFPEPDLTVEISESATPGTRFPLESAFDPDVGTNSLRDYEITPNSYFSLDVQTQGDGNRFAELVLEKPLDREQQAVHRYVLTAVDGGGGGGGGEGGGGGGGAGLPPQQQRTGTALLTIRVLDSNDNVPAFDQPVYTVSLPENSPPGTLVIQLNATDPDEGQNGEVVYSFSSHISPRARELFGLSPRTGRLEVSGELDYEESPVYQVYVQAKDLGPNAVPAHCKVLVRVLDANDNAPEISFSTVKEAVSEGAAPGTVVALFSVTDRDSEENGQVQCELLGDVPFRLKSSFKNYYTIVTEAPLDREAGDSYTLTVVARDRGEPALSTSKSIQVQVSDVNDNAPRFSQPVYDVYVTENNVPGAYIYAVSATDRDEGANAKLTYSILECQIQGMSVFTYVSINSDNGYLYALRSFDYEQIKDFSFQVEARDAGSPQALAGNATVNILIVDQNDNAPAIVAPLPGRNGTPAREVLPRSAEPGYLLTRVAAVDADDGENARLTYSIVRGNEMNLFRLDWRTGELRTARRVPAKRDPQRPYELVIEVRDHGQPPLSSTATLVVQLVDGAVEPQGGGGDRGGGSGEHLRPSRSGGGETSLDLTLILIIALGSVSFIFLLAMIVLAVRCQKEKKLNIYTCLASDCCLCCCCCGNGSSTCCGRQARARKKKLSKSDIMLVQSANVPSNPAQVPVEESGGFGSHHHNQNYCYQVCLTPESAKTDLMFLKPCSPSRSTDAEHNPCGAIVTGYSDQQPDIISNGSILSNENKHQRAELSYLVDRPRRVNSSAFQEADIVSSKDSGHGDSEQGDSDHDVTNRGQSAGMDLFSNCTEECKALGHSDRCWMPSFVPSDGRQAADYRSNLHVPGMDSVPDTEVFEPPEVQPGAERSFSTFGKEKALHGTLERKELDGLLSNTRAPYKPPYLTRKRIC 194842F7A31431CC cyfp1_mouse Cytoplasmic FMR1-interacting protein 1 Cyfip1 Shyc Kiaa0068 Sra1 Specifically Rac1-associated protein 1 protein protein mouse Mus musculus Mouse MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVTKLMNFMYFQRNAIERFCGEVRRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNKITQSLQQQLEVISGYEELLADIVNLCVDYYENRMYLTPSEKHMLLKVMGFGLYLMDGSVSNIYKLDAKKRINLSKIDKYFKQLQVVPLFGDMQIELARYIKTSAHYEENKSRWTCASSSSSPQYNICEQMIQIREDHMRFISELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLALQGLQLLSQWSAHVMEVYSWKLVHPTDKYSNKDCPDNAEEYERATRYNYTTEEKFALVEVIAMIKGLQVLMGRMESVFNHAIRHTVYAALQDFSQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCDWETGHEPFNDPALRGEKDPKSGFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESFFYTHLINFSETLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASMMEYVLYSLDLYNDSAHYALTKFNKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVMAGSLLLDKRLRSECKNQGATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSLELAIGRFESEDLTSVVELDGLLEINRMTHKLLSRYLTLDSFDAMFREANHNVSAPYGRITLHVFWELNYDFLPNYCYNGSTNRFVRTVLPFSQEFQRDKQPNAQPQYLHGSKALNLAYSSIYGSYRNFVGPPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKICRLPRHEYGSPGILEFFHHQLKDIVEYAELKTVCFQNLREVGNAVLFCLLIEQSLSLEEVCDLLHAAPFQNILPRIHVKEGERVDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRTFLDDPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCIPVGTHEFTVEQCFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVPLKKMVERIRKFQILNDEIITILDKYLKSGDGESTPVEHVRCFQPPIHQSLASS 793986FB417CF19B pcd18_human Protocadherin-18 PCDH18 KIAA1562 protein protein human Homo sapiens Human MHQMNAKMHFRFVFALLIVSFNHDVLGKNLKYRIYEEQRVGSVIARLSEDVADVLLKLPNPSTVRFRAMQRGNSPLLVVNEDNGEISIGATIDREQLCQKNLNCSIEFDVITLPTEHLQLFHIEVEVLDINDNSPQFSRSLIPIEISESAAVGTRIPLDSAFDPDVGENSLHTYSLSANDFFNIEVRTRTDGAKYAELIVVRELDRELKSSYELQLTASDMGVPQRSGSSILKISISDSNDNSPAFEQQSYIIQLLENSPVGTLLLDLNATDPDEGANGKIVYSFSSHVSPKIMETFKIDSERGHLTLFKQVDYEITKSYEIDVQAQDLGPNSIPAHCKIIIKVVDVNDNKPEININLMSPGKEEISYIFEGDPIDTFVALVRVQDKDSGLNGEIVCKLHGHGHFKLQKTYENNYLILTNATLDREKRSEYSLTVIAEDRGTPSLSTVKHFTVQINDINDNPPHFQRSRYEFVISENNSPGAYITTVTATDPDLGENGQVTYTILESFILGSSITTYVTIDPSNGAIYALRIFDHEEVSQITFVVEARDGGSPKQLVSNTTVVLTIIDENDNVPVVIGPALRNNTAEITIPKGAESGFHVTRIRAIDRDSGVNAELSCAIVAGNEENIFIIDPRSCDIHTNVSMDSVPYTEWELSVIIQDKGNPQLHTKVLLKCMIFEYAESVTSTAMTSVSQASLDVSMIIIISLGAICAVLLVIMVLFATRCNREKKDTRSYNCRVAESTYQHHPKRPSRQIHKGDITLVPTINGTLPIRSHHRSSPSSSPTLERGQMGSRQSHNSHQSLNSLVTISSNHVPENFSLELTHATPAVEQVSQLLSMLHQGQYQPRPSFRGNKYSRSYRYALQDMDKFSLKDSGRGDSEAGDSDYDLGRDSPIDRLLGEGFSDLFLTDGRIPAAMRLCTEECRVLGHSDQCWMPPLPSPSSDYRSNMFIPGEEFPTQPQQQHPHQSLEDDAQPADSGEKKKSFSTFGKDSPNDEDTGDTSTSSLLSEMSSVFQRLLPPSLDTYSECSEVDRSNSLERRKGPLPAKTVGYPQGVAAWAASTHFQNPTTNCGPPLGTHSSVQPSSKWLPAMEEIPENYEEDDFDNVLNHLNDGKHELMDASELVAEINKLLQDVRQS 7C268409AC3EEB7D pcd17_human Protocadherin-17 PCDH17 PCDH68 PCH68 Protocadherin-68 protein protein human Homo sapiens Human MYLSICCCFLLWAPALTLKNLNYSVPEEQGAGTVIGNIGRDARLQPGLPPAERGGGGRSKSGSYRVLENSAPHLLDVDADSGLLYTKQRIDRESLCRHNAKCQLSLEVFANDKEICMIKVEIQDINDNAPSFSSDQIEMDISENAAPGTRFPLTSAHDPDAGENGLRTYLLTRDDHGLFGLDVKSRGDGTKFPELVIQKALDREQQNHHTLVLTALDGGEPPRSATVQINVKVIDSNDNSPVFEAPSYLVELPENAPLGTVVIDLNATDADEGPNGEVLYSFSSYVPDRVRELFSIDPKTGLIRVKGNLDYEENGMLEIDVQARDLGPNPIPAHCKVTVKLIDRNDNAPSIGFVSVRQGALSEAAPPGTVIALVRVTDRDSGKNGQLQCRVLGGGGTGGGGGLGGPGGSVPFKLEENYDNFYTVVTDRPLDRETQDEYNVTIVARDGGSPPLNSTKSFAIKILDENDNPPRFTKGLYVLQVHENNIPGEYLGSVLAQDPDLGQNGTVSYSILPSHIGDVSIYTYVSVNPTNGAIYALRSFNFEQTKAFEFKVLAKDSGAPAHLESNATVRVTVLDVNDNAPVIVLPTLQNDTAELQVPRNAGLGYLVSTVRALDSDFGESGRLTYEIVDGNDDHLFEIDPSSGEIRTLHPFWEDVTPVVELVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQHHWDMSLPLIVTLSTISIILLAAMITIAVKCKRENKEIRTYNCRIAEYSHPQLGGGKGKKKKINKNDIMLVQSEVEERNAMNVMNVVSSPSLATSPMYFDYQTRLPLSSPRSEVMYLKPASNNLTVPQGHAGCHTSFTGQGTNASETPATRMSIIQTDNFPAEPNYMGSRQQFVQSSSTFKDPERASLRDSGHGDSDQADSDQDTNKGSCCDMSVREALKMKTTSTKSQPLEQEPEECVNCTDECRVLGHSDRCWMPQFPAANQAENADYRTNLFVPTVEANVETETYETVNPTGKKTFCTFGKDKREHTILIANVKPYLKAKRALSPLLQEVPSASSSPTKACIEPCTSTKGSLDGCEAKPGALAEASSQYLPTDSQYLSPSKQPRDPPFMASDQMARVFADVHSRASRDSSEMGAVLEQLDHPNRDLGRESVDAEEVVREIDKLLQDCRGNDPVAVRK F687502B563B4013 cyfp1_human Cytoplasmic FMR1-interacting protein 1 Specifically Rac1-associated protein 1 p140sra-1 CYFIP1 KIAA0068 protein protein human Homo sapiens Human MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVTKLMNFMYFQRNAIERFCGEVRRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNKITQSLQQQLEVISGYEELLADIVNLCVDYYENRMYLTPSEKHMLLKVMGFGLYLMDGSVSNIYKLDAKKRINLSKIDKYFKQLQVVPLFGDMQIELARYIKTSAHYEENKSRWTCTSSGSSPQYNICEQMIQIREDHMRFISELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLALQGLQLLSQWSAHVMEVYSWKLVHPTDKYSNKDCPDSAEEYERATRYNYTSEEKFALVEVIAMIKGLQVLMGRMESVFNHAIRHTVYAALQDFSQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCDWETGHEPFNDPALRGEKDPKSGFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESFFYTHLINFSETLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASMMEYVLYSLDLYNDSAHYALTRFNKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVMAGSLLLDKRLRSECKNQGATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSLELAIGRFESEDLTSIVELDGLLEINRMTHKLLSRYLTLDGFDAMFREANHNVSAPYGRITLHVFWELNYDFLPNYCYNGSTNRFVRTVLPFSQEFQRDKQPNAQPQYLHGSKALNLAYSSIYGSYRNFVGPPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKICRLPRHEYGSPGILEFFHHQLKDIVEYAELKTVCFQNLREVGNAILFCLLIEQSLSLEEVCDLLHAAPFQNILPRVHVKEGERLDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSFLDDPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCIPVGTHEFTVEQCFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVPLKKMVERIRKFQILNDEIITILDKYLKSGDGEGTPVEHVRCFQPPIHQSLASS DIP protein Q7L576 original sequence version: 55 DIP protein Q7L576-1 original sequence version: 59 DIP protein Q7L576 original sequence version: 59 DIP protein Q7L576 original sequence version: 100 D8F45E13207BEF16 q9vkm2_drome Wiskott-Aldrich syndrome protein family member SCAR Scar BEST:SD02991 D-SCAR DWave DmSCAR Dmel\CG4636 Dscar WAVE Wave dWAVE l(2)k03107 l(2)k13811 scar wave Dmel_CG4636 CG4636 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARDVGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMPAPMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGKKLNRPRQDGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSMVNEEAGYGNMGVYDTRPPRPNSIELNRSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMGGPQQMHMQHQQMYDAGMYQSHALYGQTGQGVMSPEPIYGPGTPSRNKPRPSQPPPAPPSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNGVNSGHMAAKLLGRANSSSGAGSPNSVQNANDMVMTQLSNTFHSIGMTGNQLNSLSDLPPPPPVPDQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEMQQPGQQNGVPHIVAPKKMLPPFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIELSESEDSDSEDDSEGWMEPNETSA DIP protein Q9VKM2 original sequence version: 63 C81578E9FC3F2E95 nlgn1_human Neuroligin-1 NLGN1 KIAA1070 protein protein human Homo sapiens Human MALPRCTWPNYVWRAVMACLVHRGLGAPLTLCMLGCLLQAGHVLSQKLDDVDPLVATNFGKIRGIKKELNNEILGPVIQFLGVPYAAPPTGERRFQPPEPPSPWSDIRNATQFAPVCPQNIIDGRLPEVMLPVWFTNNLDVVSSYVQDQSEDCLYLNIYVPTEDVKRISKECARKPGKKICRKGGPLTKKQTDDLGDNDGAEDEDIRDSGGPKPVMVYIHGGSYMEGTGNLYDGSVLASYGNVIVITVNYRLGVLGFLSTGDQAAKGNYGLLDLIQALRWTSENIGFFGGDPLRITVFGSGAGGSCVNLLTLSHYSEGNRWSNSTKGLFQRAIAQSGTALSSWAVSFQPAKYARMLATKVGCNVSDTVELVECLQKKPYKELVDQDIQPARYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGVNQGEGLKFVENIVDSDDGISASDFDFAVSNFVDNLYGYPEGKDVLRETIKFMYTDWADRHNPETRRKTLLALFTDHQWVAPAVATADLHSNFGSPTYFYAFYHHCQTDQVPAWADAAHGDEVPYVLGIPMIGPTELFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWTRYSQKDQLYLHIGLKPRVKEHYRANKVNLWLELVPHLHNLNDISQYTSTTTKVPSTDITFRPTRKNSVPVTSAFPTAKQDDPKQQPSPFSVDQRDYSTELSVTIAVGASLLFLNILAFAALYYKKDKRRHDVHRRCSPQRTTTNDLTHAQEEEIMSLQMKHTDLDHECESIHPHEVVLRTACPPDYTLAMRRSPDDVPLMTPNTITMIPNTIPGIQPLHTFNTFTGGQNNTLPHPHPHPHSHSTTRV mint Neuronal cell surface protein thought to be involved in cell-cell-interactions by forming intercellular junctions through binding to beta-neurexins. Seems to play role in formation or maintenance of synaptic junctions. In vitro, triggers the de novo formation of presynaptic structures. May be involved in specification of excitatory synapses FDF64A8325A075E2 fat3_mouse Protocadherin Fat 3 Fat3 Gm1132 Gm510 FAT tumor suppressor homolog 3 protein protein mouse Mus musculus Mouse MSVTMGHCMGTKPPSCIILLLLKLFATVSQGLPGTGPLGFHFTHSTYNATVYENSAARTYVNSQSRMGITLIDLSWDIKYRIVSGDEEGFFKAEEVIIADFCFLRIRTKGGNSAILNREIQDNYLLIIKGSVRGEDLEAWTKVNIQVLDMNDLRPLFSPTTYSVTIAESTPLRTSVAQVTATDADIGSNGEFYYYFKNKVDLFSVHPTSGVISLSGRLNYDEKNRYDLEILAVDRGMKLYGNNGVSSTAKLYVHIERINEHAPIIHVVSHTPFSLDKEPTYAVVTVDDLDEGANGEIESLSIVDGDPLEQFFLAKEGKWLNEYKVKERRQVDWESFSYGYNLTIQAKDKGSPQKFSELKTVHIANPRRDNTPVRFEKDVYEVSISEFSPPGVLVAIVKVSPEPLDVEYKLLPGKDSDYFKINPRSGLIVTAQPLNTVKKEVYKLEVSDKEGDAKAQVTIGIEDANDHTPEFQEALYETFVNESVRVGTNVLTVSASDKDKGENGYITYSIASLNLLPFAINQFTGVISTTEELDFESSPETYRFIVRASDWGSPYRHESEVNVTIRVGNVNDNSPLFEKVACQGVISYDFPVGGHITAISAIDIDELELVKYKIISGNELGFFYLNPDSGVLQLKKSLMNSGIKNGNFALRITATDGENFADPMAINISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSINRQGPHFDKSFPSDVAVKEDMLVGTNILKIKAYDADSGFNGKVLFTISDGNTDSCFNIDMETGQLKVLMPMDREHTDLYVLNITIYDLGKPQKSSWRLLTVNVEDANDNNPVFLQDSYSVSILESSSIGTEIIQVEARDKDLGSNGEVMYSVLTDTHQFIINSSTGIVYIADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKIFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAWLETQDPDLGLGGQVRYSLVNDYNGRFEVDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTAHDEDSGRDGEIQYSIRDGSGLGRFNIDDESGVITAADSLDRETTASYWLTVYATDRGVVPLYSTIEVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSGSNEKLTYRITSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGSSPKQSTIWVVVQVLDENDNRPQFPEKVYQIKLPERDRKKRGEPIYRAFAFDKDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSSRKQFTAGSYDILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDKVTEIVGVVSVQPANTPLWFDIVGGNFDSSFDAEKGVGTIVIAKPLDAEQRSVYNMSVEVTDGTNIAVTQVFIKVLDNNDNGPEFSQPHYDVTISEDVLPDTEILQIEATDRDEKHKLSYTIHSSIDAVSMRKFRMDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDHSPYFTNPLYEASVFESAALGSVVLQVTALDKDKGENAELIYSIEAGNTGNTFKIEPVLGIITISKEPDMAAMGQFVLSVKVTDQGSPPMSATAIVRISISMSDNSHPKFTHKDYQAEVNENVDIGTSVILISAISQSTLIYEVKDGNINGVFTINPYSGVITTRRALDYEHTSSYQLIIQATNMAGMASNATISVQIVDENDNPPVFLFSQYSGSLSEAAPINSIVRSLDNSPLVIRATDADSNQNALLVYQIVESTAKKFFTVDSSTGAIRTIANLDHEAIAHFHFHVHVRDSGNPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETVLLLPTYIGVEVLKVSATDPDSEVPPELTYSLMEGSVDNFLMDPNTGVLTIKNNNLSKDHYMLIVRVSDGKFYSTAMVTVMVKEAMDSGLHFTQSFYSTSISENSTNITKVAIVNAVGNRLNEPLKYSILNPGNKFKIKSTSGVIQTTGVPFDREEQELYELVVEASRELDHLRVARVVVRVNIEDVNDNSPVFVGLPYYAAVQVDAEPGTLIYRVTAIDKDKGANGEVTYVLQDDYGHFEINPNSGNVILREAFNSDLSNIDYGVTILAKDGGNPSLSTFVELPITIVNKAMPVFDKPFYTASINEDITMNTPILSINATSPEGQGIIYLIIDGDPFQQFNIDFDTGVLKVISPLDYEVTSVYKLTVRASDALTGARAEVTVDLLVDDINDNPPVFDQPTYNTTLSESSLIGTPVLQLVSTDADSGNNKLVRYQIVQDTYNSTDYFHIDSSSGLILTARMLDHELVQHCTLKVTATDNGFPSLSSEVLVQIYISDVNDNPPVFNQLIYESYVSELAPRGHFVTCVQASDADSSDLDRLEYSILSGNDRASFLMDSKSGVLTLSSHRKQRMEPLYSLNVSVSDGLFTSTAQVHIRVLGANLYSPAFSQSTYVAEVRENAASGTKVIHVRATDGDPGTYGQVSYSIINDFAKDRFLIDSNGQIITTERLDRENPLEGDISIYLRALDGGGRTTFCTVRVIVVDENDNAPQFMTVEYRASVRADVGRGHLVTQVQALDPDDGANSRITYSLYSEASVSVADLLEIDPDNGWMVTKGNFNQLRNTVLSFFVKAVDGGIPVRHSLIPVYIHVLPPETFLPSFTQSQYSFTITEDTSIGSTVDTLRILPNQSVRFSMVNGERPENNKEGVFIIEQETGAIKLDKRLDHEVSPAFHFKVAATIPLDKVDIVFTVDVDVKVLDLNDNKPVFETSTYETIIMEGMPVGTKLAQVRAIDMDWGANGQVTYSLHSDSHLEKVIEAFNIDSNTGWISTLKDLDHETDPAFSFFVVASDLGEAFSLSSMALVSVKVTDINDNAPVFAHEVYRGNVKESDPPGEVVAVLSTLDKDTSNINRQVSYHITGGNPRGQFALGMVQSEWKVYVKRPLDREEQDIYFLNITASDGLFVTQAMVEVTVSDVNDNSPVCDQVAYSASLPEDIPSNKIILKVSAKDADIGSNGDIRYSLYGSGNNEFFLDPESGELKTLAVLDRERVPVYNLIARATDGGGRFCSSSVLLLLEDVNDNPPVFSSNHYTACVYENTATKALLTRVQAMDPDVGINRKVVYSLEDSASGVFSIDSSSGVIVLEQPLDREQQSSYNISVRATDQSPGQSLSSLASVTITVLDINDNPPVFERRDYLVTVPEDTSLGTQVLSVFATSKDIGTNAEITYLIRSGNEQGKFSINPKTGGISVLEALDYETCRRFYLVVEAKDGGTPALSTAATVSIDLTDVNDNPPRFSQDVYSAVISEDALEGDSVILLIAEDVDSKPNGQIRFSIVGGDRDNEFAVDPILGLVKVKKKLDRERVSGYSLLIQAVDSGIPAMSSTTTVNIDISDVNDNSPVFTPANYTAVIQENKPVGTSILQLVVTDRDSFHNGPPFSFSILSGNEDEEFMLDSHGILRSAVVFRHMESPEYLLCIQAKDSGKPQQVSHTYIRVRVIEESTHKPTAIPLEIFIVTMEDDFPGGVIGKIHATDQDMYDVLTFALKSEQKSLFKVNSHDGKIIALGGLDSGKYVLNVSVSDGRFQVPIDVVVHVEQLVHEMLQNTVTIRFEDVSPEDFVGLHMHGFRRILRNAVLTQKQDSLRIISIQPVVGTNQLDMLFAVEMHSSEFYKPAYLIQKLSNARRHLENVMHIAAILEKNCSGLDCQEQHCEQGLSLDSHALMTYSTARISFVCPRFYRNVRCTCNGGVCPGSNDPCVEKPCPEDMQCVGYEASRRPFLCQCPPGKLGECSGHTSLSFAGNSYIKYRLSENSKEEDFKLALRLRTLQSNGIIMYTRANPCMILKIVEGKLWFQLDCGSGPGILGISSRAVNDGSWHSVFLELNRNFTSLALDDSYVERRRAPLYFQTLSTDSAIFFGALVQADNVRSLTDTRVTQVLGGFQGCLDSVVLNHYELPLQNKRSSFAEVVGLTELKLGCVLYPDACQRSPCLHGGSCSSLPSGGYQCSCLSQFTGTNCESEITACFPNPCRNGGSCDPIGNTFVCSCKAGLTGVTCEDDVDECEREECENGGSCVNLFGSFFCNCTPGYVGQYCGLRPVVVPNIQAGHSYVGKEELIGIAVVLFVIFTLIVLFIVFRKKVFRKNYSRNNITLVQDPATAALLHKSNGIPFRSLRAGDGRNVYQEVGPPQVPVRPMAYTPCFQSDSRSNLDKGLDVLGGEPQEMSTFHPESPRILTARRGVVVCSVAPNLPAVSPCRSDCDSIRKNGWDTGSENKGTEDTGEVTCFTNSNKGSNSEVQSLSSFQSDSGDDNAYHWDTSDWMPGARLSDIEEMPNYESQDGGAAHQGSTRELESDYYLGGYDIDSEYPPPHEEEFLSRDQLPPPLPEDFPDQYEALPPSQPTSLTSTMSPDCRRRPRFHPSQYLPPHPLPGETDLGGPSSSCDFSTFAVNMNQGTEVMAPTDSVSLSLHNSRGTSSSEMSARCGFDDSEVAMSDYESAGELSLTNLHIPFVETQQQTQV 4E23122CCAC98DDD wasf1_mouse Wiskott-Aldrich syndrome protein family member 1 Protein WAVE-1 Wasf1 Wave1 protein protein mouse Mus musculus Mouse MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDDADLLHKHIEVANGPASHYETRPQTYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGDAKPTPTCISSATGLIENRPQSPAAGRTPVFVSPTPPPPPPPLPSALSTSSLRASMTSTPPPPVPPPPPPPATALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQPSPPVARAAPVCETVPVHPLPQGEVQGLPPPPPPPPLPPPGIRPSSPVAVAALAHPPSGLHPAPSTAPGPHAPLMPPSPPSQVLPASEPKRHPSTLPVISDARSVLLEAIRKGIQLRKVEEQREQEAKHERIENDVATILSRRIAVEYSDSEDDSEFDEVDWLE 8746910987D80D16 abi2_human Abl interactor 2 Abelson interactor 2 Abl-binding protein 3 Arg-binding protein 1 ABI2 ARGBPIA protein protein human Homo sapiens Human MAELQMLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVKWLLRFKVSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGRHSPYRTLEPVRPPVVPNDYVPSPTRNMAPSQQSPVRTASVNQRNRTYSSSGSSGGSHPSSRSSSRENSGSGSVGVPIAVPTPSPPSVFPAPAGSAGTPPLPATSASAPAPLVPATVPSSTAPNAAAGGAPNLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRHTPPTIGGSLPYRRPPSITSQTSLQNQMNGGPFYSQNPVSDTPPPPPPVEEPVFDESPPPPPPPEDYEEEEAAVVEYSDPYAEEDPPWAPRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESIMHYSE DIP protein Q9NYB9 original sequence version: 84 DIP protein Q9NYB9 original sequence version: 88 DIP protein Q9NYB9 original sequence version: 131 822983A69E5EA512 cac1d_human Voltage-dependent L-type calcium channel subunit alpha-1D CACH3 CACN4 CACNL1A2 CCHL1A2 Calcium channel, L type, alpha-1 polypeptide, isoform 2 Voltage-gated calcium channel subunit alpha Cav1.3 CACNA1D protein protein human Homo sapiens Human MMMMMMMKKMQHQRQQQADHANEANYARGTRLPLSGEGPTSQPNSSKQTVLSWQAAIDAARQAKAAQTMSTSAPPPVGSLSQRKRQQYAKSKKQGNSSNSRPARALFCLSLNNPIRRACISIVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKIIAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKTCFFADSDIVAEEDPAPCAFSGNGRQCTANGTECRSGWVGPNGGITNFDNFAFAMLTVFQCITMEGWTDVLYWMNDAMGFELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEEGKRNTSMPTSETESVNTENVSGEGENRGCCGSLCQAISKSKLSRRWRRWNRFNRRRCRAAVKSVTFYWLVIVLVFLNTLTISSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVTRHWTSLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAESLNTAQKEEAEEKERKKIARKESLENKKNNKPEVNQIANSDNKVTIDDYREEDEDKDPYPPCDVPVGEEEEEEEEDEPEVPAGPRPRRISELNMKEKIAPIPEGSAFFILSKTNPIRVGCHKLINHHIFTNLILVFIMLSSAALAAEDPIRSHSFRNTILGYFDYAFTAIFTVEILLKMTTFGAFLHKGAFCRNYFNLLDMLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDEAKSNPEECRGLFILYKDGDVDSPVVRERIWQNSDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENIGPIYNHRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSSPFEYMMFVLIMLNTLCLAMQHYEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAFKPKGYFSDAWNTFDSLIVIGSIIDVALSEADPTESENVPVPTATPGNSEESNRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPGKLCDPESDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGNLEQANEELRAVIKKIWKKTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEQGLVGKYPAKNTTIALQAGLRTLHDIGPEIRRAISCDLQDDEPEETKREEEDDVFKRNGALLGNHVNHVNSDRRDSLQQTNTTHRPLHVQRPSIPPASDTEKPLFPPAGNSVCHNHHNHNSIGKQVPTSTNANLNNANMSKAAHGKRPSIGNLEHVSENGHHSSHKHDREPQRRSSVKRTRYYETYIRSDSGDEQLPTICREDPEIHGYFRDPHCLGEQEYFSSEECYEDDSSPTWSRQNYGYYSRYPGRNIDSERPRGYHHPQGFLEDDDSPVCYDSRRSPRRRLLPPTPASHRRSSFNFECLRRQSSQEEVPSSPIFPHRTALPLHLMQQQIMAVAGLDSSKAQKYSPSHSTRSWATPPATPPYRDWTPCYTPLIQVEQSEALDQVNGSLPSLHRSSWYTDEPDISYRTFTPASLTVPSSFRNKNSDKQRSADSLVEAVLISEGLGRYARDPKFVSATKHEIADACDLTIDEMESAASTLLNGNVRPRANGDVGPLSHRQDYELQDFGPGYSDEEPDPGRDEEDLADEMICITTL DIP protein Q01668 original sequence version: 105 31B0ADFCDB30B575 nlgnx_human Neuroligin-4, X-linked NLGN4X KIAA1260 NLGN4 HNLX UNQ365/PRO701 protein protein human Homo sapiens Human MSRPQGLLWLPLLFTPVCVMLNSNVLLWLTALAIKFTLIDSQAQYPVVNTNYGKIRGLRTPLPNEILGPVEQYLGVPYASPPTGERRFQPPEPPSSWTGIRNTTQFAAVCPQHLDERSLLHDMLPIWFTANLDTLMTYVQDQNEDCLYLNIYVPTEDDIHDQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRILADKVGCNMLDTTDMVECLRNKNYKELIQQTITPATYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPNDFDFSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADKENPETRRKTLVALFTDHQWVAPAVATADLHAQYGSPTYFYAFYHHCQSEMKPSWADSAHGDEVPYVFGIPMIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNLNEIFQYVSTTTKVPPPDMTSFPYGTRRSPAKIWPTTKRPAITPANNPKHSKDPHKTGPEDTTVLIETKRDYSTELSVTIAVGASLLFLNILAFAALYYKKDKRRHETHRRPSPQRNTTNDIAHIQNEEIMSLQMKQLEHDHECESLQAHDTLRLTCPPDYTLTLRRSPDDIPLMTPNTITMIPNTLTGMQPLHTFNTFSGGQNSTNLPHGHSTTRV EA1320D690F76BBD nckp1_human Nck-associated protein 1 NCKAP1 HEM2 KIAA0587 NAP1 p125Nap1 Membrane-associated protein HEM-2 protein protein human Homo sapiens Human MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVFFDITVNFDLTKNYLDLIITYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYENPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISAPSTMLNPAQSDTMPCEYLSLDAMEKWIIFGFILCHGILNTDATALNLWKLALQSSSCLSLFRDEVFHIHKAAEDLFVNIRGYNKRINDIRECKEAAVSHAGSMHRERRKFLRSALKELATVLSDQPGLLGPKALFVFMALSFARDEIIWLLRHADNMPKKSADDFIDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQNLSVCPEDESIIMSSFVNTMTSLSVKQVEDGEVFDFRGMRLDWFRLQAYTSVSKASLGLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSIAFPLLCTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHCAKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLVVTNLDKLHTALSELCFSINYVPNMVVWEHTFTPREYLTSHLEIRFTKSIVGMTMYNQATQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENELTFNAEEYSDISEMRSLSELLGPYGMKFLSESLMWHISSQVAELKKLVVENVDVLTQMRTSFDKPDQMAALFKRLSSVDSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVSSIEDFKDHIPRETDMKVAMNVYELSSAAGLPCEIDPALVVALSSQKSENISPEEEYKIACLLMVFVAVSLPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIHKGSIEDRLKEFLALASSSLLKIGQETDKTTTRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQSVTSSA DIP protein Q9Y2A7 original sequence version: 81 DIP protein Q9Y2A7-1 original sequence version: 85 DIP protein Q9Y2A7 original sequence version: 85 DIP protein Q9Y2A7 original sequence version: 129 12D32BAC7080CB5A pcdh8_human Protocadherin-8 PCDH8 Arcadlin protein protein human Homo sapiens Human MSPVRRWGSPCLFPLQLFSLCWVLSVAQSKTVRYSTFEEDAPGTVIGTLAEDLHMKVSGDTSFRLMKQFNSSLLRVREGDGQLTVGDAGLDRERLCGQAPQCVLAFDVVSFSQEQFRLVHVEVEVRDVNDHAPRFPRAQIPVEVSEGAAVGTRIPLEVPVDEDVGANGLQTVRLAEPHSPFRVELQTRADGAQCADLVLLQELDRESQAAYSLELVAQDGGRPPRSATAALSVRVLDANDHSPAFPQGAVAEVELAEDAPVGSLLLDLDAADPDEGPNGDVVFAFGARTPPEARRLFRLDPRSGRLTLAGPVDYERQDTYELDVRAQDRGPGPRAATCKVIVRIRDVNDNAPDIAITPLAAPGAPATSPFAAAAAAAALGGADASSPAGAGTPEAGATSLVPEGAARESLVALVSTSDRDSGANGQVRCALYGHEHFRLQPAYAGSYLVVTAASLDRERIAEYNLTLVAEDRGAPPLRTVRPYTVRVGDENDNAPLFTRPVYEVSVRENNPPGAYLATVAARDRDLGRNGQVTYRLLEAEVGRAGGAVSTYVSVDPATGAIYALRSFDYETLRQLDVRIQASDGGSPQLSSSALVQVRVLDQNDHAPVLVHPAPANGSLEVAVPGRTAKDTVVARVQARDADEGANGELAFELQQQEPREAFAIGRRTGEILLTGDLSQEPPGRVFRALLVISDGGRPPLTTTATVSFVVTAGGGRGPAAPASAGSPERSRPPGSRLGVSGSVLQWDTPLIVIIVLAGSCTLLLAAIIAIATTCNRRKKEVRKGGALREERPGAAGGGASAPGSPEEAARGAGPRPNMFDVLTFPGTGKAPFGSPAADAPPPAVAAAEVPGSEGGSATGESACHFEGQQRLRGAHAEPYGASPGFGKEPAPPVAVWKGHSFNTISGREAEKFSGKDSGKGDSDFNDSDSDISGDALKKDLINHMQSGLWACTAECKILGHSDRCWSPSCSGPNAHPSPHPPAQMSTFCKSTSLPRDPLRRDNYYQAQLPKTVGLQSVYEKVLHRDYDRTVTLLSPPRPGRLPDLQEIGVPLYQSPPGRYLSPKKGANENV CBCCE3C43C0E02D8 brk1_human Protein BRICK1 C3orf10 BRK1 HSPC300 MDS027 protein protein human Homo sapiens Human MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGETLT DIP protein Q8WUW1 original sequence version: 62 DIP protein Q8WUW1-1 original sequence version: 65 DIP protein Q8WUW1 original sequence version: 106 637B5461A2D96587 pcda6_human Protocadherin alpha-6 PCDHA6 CNRS2 protein protein human Homo sapiens Human MVFTPEDRLGKQCLLLPLLLLAAWKVGSGQLHYSVPEEAKHGTFVGRIAQDLGLELAELVPRLFRMASKDREDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIVDRPLQVFHVDVEVRDINDNPPLFPVEEQRVLIYESRLPDSVFPLEGASDADVGSNSILTYKLSSSEYFGLDVKINSDDNKQIGLLLKKSLDREEAPAHNLFLTATDGGKPELTGTVQLLVTVLDVNDNAPTFEQSEYEVRIFENADNGTTVIRLNASDRDEGANGAISYSFNSLVAAMVIDHFSIDRNTGEIVIRGNLDFEQENLYKILIDATDKGHPPMAGHCTVLVRILDKNDNVPEIALTSLSLPVREDAQFGTVIALISVNDLDSGANGQVNCSLTPHVPFKLVSTFKNYYSLVLDSALDRESVSAYELVVTARDGGSPSLWATASLSVEVADMNDNAPAFAQPEYTVFVKENNPPGCHIFTVSARDADAQENALVSYSLVERRVGERALSSYISVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLGSNVTLQVFVLDENDNAPALLAPRVGGTGGAVSELVPRSLGAGQVVAKVRAVDADSGYNAWLSYELQPPASSARFPFRVGLYTGEISTTRVLDEADSPRHRLLVLVKDHGEPALTATATVLVSLVESGQAPKASSRASVGAAGPEAALVDVNVYLIIAICAVSSLLVLTLLLYTALRCSAPPTEGACTADKPTLVCSSAVGSWSYSQQRRQRVCSGEGPPKMDLMAFSPSLSPCPIMMGKAENQDLNEDHDAKPRQPNPDWRYSASLRAGMHSSVHLEEAGILRAGPGGPDQQWPTVSSATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQSGPGELPDKFIIPGSPAIISIRQEPTNSQIDKSDFITFGKKEETKKKKKKKKGNKTQEKKEKGNSTTDNSDQ 894B97B9737C52B9 pcd19_human Protocadherin-19 PCDH19 KIAA1313 protein protein human Homo sapiens Human MESLLLPVLLLLAILWTQAAALINLKYSVEEEQRAGTVIANVAKDAREAGFALDPRQASAFRVVSNSAPHLVDINPSSGLLVTKQKIDRDLLCRQSPKCIISLEVMSSSMEICVIKVEIKDLNDNAPSFPAAQIELEISEAASPGTRIPLDSAYDPDSGSFGVQTYELTPNELFGLEIKTRGDGSRFAELVVEKSLDRETQSHYSFRITALDGGDPPRLGTVGLSIKVTDSNDNNPVFSESTYAVSVPENSPPNTPVIRLNASDPDEGTNGQVVYSFYGYVNDRTRELFQIDPHSGLVTVTGALDYEEGHVYELDVQAKDLGPNSIPAHCKVTVSVLDTNDNPPVINLLSVNSELVEVSESAPPGYVIALVRVSDRDSGLNGRVQCRLLGNVPFRLQEYESFSTILVDGRLDREQHDQYNLTIQARDGGVPMLQSAKSFTVLITDENDNHPHFSKPYYQVIVQENNTPGAYLLSVSARDPDLGLNGSVSYQIVPSQVRDMPVFTYVSINPNSGDIYALRSFNHEQTKAFEFKVLAKDGGLPSLQSNATVRVIILDVNDNTPVITAPPLINGTAEVYIPRNSGIGYLVTVVKAEDYDEGENGRVTYDMTEGDRGFFEIDQVNGEVRTTRTFGESSKSSYELIVVAHDHGKTSLSASALVLIYLSPALDAQESMGSVNLSLIFIIALGSIAGILFVTMIFVAIKCKRDNKEIRTYNCSNCLTITCLLGCFIKGQNSKCLHCISVSPISEEQDKKTEEKVSLRGKRIAEYSYGHQKKSSKKKKISKNDIRLVPRDVEETDKMNVVSCSSLTSSLNYFDYHQQTLPLGCRRSESTFLNVENQNTRNTSANHIYHHSFNSQGPQQPDLIINGVPLPETENYSFDSNYVNSRAHLIKSSSTFKDLEGNSLKDSGHEESDQTDSEHDVQRSLYCDTAVNDVLNTSVTSMGSQMPDHDQNEGFHCREECRILGHSDRCWMPRNPMPIRSKSPEHVRNIIALSIEATAADVEAYDDCGPTKRTFATFGKDVSDHPAEERPTLKGKRTVDVTICSPKVNSVIREAGNGCEAISPVTSPLHLKSSLPTKPSVSYTIALAPPARDLEQYVNNVNNGPTRPSEAEPRGADSEKVMHEVSPILKEGRNKESPGVKRLKDIVL AF8721355A33C1C2 wasf1_human Wiskott-Aldrich syndrome protein family member 1 WASF1 KIAA0269 SCAR1 WAVE1 Protein WAVE-1 Verprolin homology domain-containing protein 1 protein protein human Homo sapiens Human MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDDANLLHKHIEVANGPASHFETRPQTYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGDAKPIPTCISSATGLIENRPQSPATGRTPVFVSPTPPPPPPPLPSALSTSSLRASMTSTPPPPVPPPPPPPATALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQPSPPVARAAPVCETVPVHPLPQGEVQGLPPPPPPPPLPPPGIRPSSPVTVTALAHPPSGLHPTPSTAPGPHVPLMPPSPPSQVIPASEPKRHPSTLPVISDARSVLLEAIRKGIQLRKVEEQREQEAKHERIENDVATILSRRIAVEYSDSEDDSEFDEVDWLE DIP protein Q92558 original sequence version: 78 DIP protein Q92558 original sequence version: 82 DIP protein Q92558 original sequence version: 124 DIP protein Q92558 original sequence version: 87 44B4527BDB77BC6E lrig3_human Leucine-rich repeats and immunoglobulin-like domains protein 3 LRIG3 LIG3 UNQ287/PRO326/PRO335 protein protein human Homo sapiens Human MSAPSLRARAAGLGLLLCAVLGRAGRSDSGGRGELGQPSGVAAERPCPTTCRCLGDLLDCSRKRLARLPEPLPSWVARLDLSHNRLSFIKASSMSHLQSLREVKLNNNELETIPNLGPVSANITLLSLAGNRIVEILPEHLKEFQSLETLDLSSNNISELQTAFPALQLKYLYLNSNRVTSMEPGYFDNLANTLLVLKLNRNRISAIPPKMFKLPQLQHLELNRNKIKNVDGLTFQGLGALKSLKMQRNGVTKLMDGAFWGLSNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQNAINRISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNTLHIGNNRVSYIADCAFRGLSSLKTLDLKNNEISWTIEDMNGAFSGLDKLRRLILQGNRIRSITKKAFTGLDALEHLDLSDNAIMSLQGNAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQSFVNASCAHPQLLKGRSIFAVSPDGFVCDDFPKPQITVQPETQSAIKGSNLSFICSAASSSDSPMTFAWKKDNELLHDAEMENYAHLRAQGGEVMEYTTILRLREVEFASEGKYQCVISNHFGSSYSVKAKLTVNMLPSFTKTPMDLTIRAGAMARLECAAVGHPAPQIAWQKDGGTDFPAARERRMHVMPEDDVFFIVDVKIEDIGVYSCTAQNSAGSISANATLTVLETPSFLRPLLDRTVTKGETAVLQCIAGGSPPPKLNWTKDDSPLVVTERHFFAAGNQLLIIVDSDVSDAGKYTCEMSNTLGTERGNVRLSVIPTPTCDSPQMTAPSLDDDGWATVGVVIIAVVCCVVGTSLVWVVIIYHTRRRNEDCSITNTDETNLPADIPSYLSSQGTLADRQDGYVSSESGSHHQFVTSSGAGFFLPQHDSSGTCHIDNSSEADVEAATDLFLCPFLGSTGPMYLKGNVYGSDPFETYHTGCSPDPRTVLMDHYEPSYIKKKECYPCSHPSEESCERSFSNISWPSHVRKLLNTSYSHNEGPGMKNLCLNKSSLDFSANPEPASVASSNSFMGTFGKALRRPHLDAYSSFGQPSDCQPRAFYLKAHSSPDLDSGSEEDGKERTDFQEENHICTFKQTLENYRTPNFQSYDLDT EB3B6A391F3C8713 pcd10_human Protocadherin-10 PCDH10 KIAA1400 protein protein human Homo sapiens Human MIVLLLFALLWMVEGVFSQLHYTVQEEQEHGTFVGNIAEDLGLDITKLSARGFQTVPNSRTPYLDLNLETGVLYVNEKIDREQICKQSPSCVLHLEVFLENPLELFQVEIEVLDINDNPPSFPEPDLTVEISESATPGTRFPLESAFDPDVGTNSLRDYEITPNSYFSLDVQTQGDGNRFAELVLEKPLDREQQAVHRYVLTAVDGGGGGGVGEGGGGGGGAGLPPQQQRTGTALLTIRVLDSNDNVPAFDQPVYTVSLPENSPPGTLVIQLNATDPDEGQNGEVVYSFSSHISPRARELFGLSPRTGRLEVSGELDYEESPVYQVYVQAKDLGPNAVPAHCKVLVRVLDANDNAPEISFSTVKEAVSEGAAPGTVVALFSVTDRDSEENGQVQCELLGDVPFRLKSSFKNYYTIVTEAPLDREAGDSYTLTVVARDRGEPALSTSKSIQVQVSDVNDNAPRFSQPVYDVYVTENNVPGAYIYAVSATDRDEGANAQLAYSILECQIQGMSVFTYVSINSENGYLYALRSFDYEQLKDFSFQVEARDAGSPQALAGNATVNILIVDQNDNAPAIVAPLPGRNGTPAREVLPRSAEPGYLLTRVAAVDADDGENARLTYSIVRGNEMNLFRMDWRTGELRTARRVPAKRDPQRPYELVIEVRDHGQPPLSSTATLVVQLVDGAVEPQGGGGSGGGGSGEHQRPSRSGGGETSLDLTLILIIALGSVSFIFLLAMIVLAVRCQKEKKLNIYTCLASDCCLCCCCCGGGGSTCCGRQARARKKKLSKSDIMLVQSSNVPSNPAQVPIEESGGFGSHHHNQNYCYQVCLTPESAKTDLMFLKPCSPSRSTDTEHNPCGAIVTGYTDQQPDIISNGSILSNETKHQRAELSYLVDRPRRVNSSAFQEADIVSSKDSGHGDSEQGDSDHDATNRAQSAGMDLFSNCTEECKALGHSDRCWMPSFVPSDGRQAADYRSNLHVPGMDSVPDTEVFETPEAQPGAERSFSTFGKEKALHSTLERKELDGLLTNTRAPYKPPYLTRKRIC DE53F8B1A7198F85 cyfip_drome Cytoplasmic FMR1-interacting protein Sra-1 Cyfip CG4931 Specifically Rac1-associated protein 1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTEKITLADALSNVEVLDELSLPDEQPCIEAQPCSIIYKANFDTNFEDRNGFVTGIAKYIEEATTHANLNVLLDEGQKHAVMLYTWRCCSRAIPQPKSNEQPNRVEIYEKTVEVLAPEVNKLLNFMYFQRKAIEAFSGEVKRLCHAEKRKDFVSEAYLLTLGKFINMFAVLDELKNMKSSVKNDYSTYRRAAQFLKVMSDSHTLQESQNLSMFLATQNKIRDTVKDTLEKIVGYEDLLSDVVNICVHMFETKMYLTPEEKHMLVKVMGFGLFLMDSDACNINKLDQKKKIRLDRIDRIFKNLEVVPLFGDMQIAPFNYIKRSKHFDSSKWPLSSSNAISPQADLMVHLPQIREDHVKYISELARYTNEVTTTVKENPSDAENRITADLALRGLQLLSEWTSVVTELYSWKLLHPTDHHQNKECPVEAEEYERATRYNYTSEEKFALIEVIAMIKGLQVLMARIETVLCEAIRRNIYSELQDFVQLSLREPLRKAVKNKKDLIRSIIMSVRETSADWQKGYEPTDDPVAKGKKDPDGGFRIQVPRLNVGPSSTQLYMVRTMLESLIADKSGGKRTLRKDIDGNCLLQIDTFHKTSFYWSYLLNFSDTLQKCCDLSQLWYREFYLEMTMGRKVNKCLVRHQHNEECKDLITMEKRIQFPIEMSMPWILTDHILQTKEPSMMEFVLYPLDLYNDSAYYALTVFRKQFLYDEVEAEVNLCFDQFVYKLSEQIFAHYKQLAGSIFLDKRFRLECEVLGFNFQSYPRNNRYETLLKQRHVQLLGRSIDLNKLITQRINANMHKSIELAISRFEGNDITGIVELEGLLEANRICHKLLSKYLALDNFDGMVKEANHNVLAPYGRITLHVFVELNYDFLVNYCYNAATNRFIRTKVNLSSSQAIQREKPPQMSHYYLWGSKQLNAAYSTQYGQYTGFVGSPHFHAMCRLLGYQGIAVVMDIILKDIVKPLIQGSLLQFTKTLMIAMPKSCKLPRCEYGSPGVLSYYQAHLTDIVQYPDAKTELFQSFREFGNSIIFCLLIEQALSQEEVCDLLHAALFQNIFPRPFCKENEKPEAKQKRLEAQFANLQIVSNVEKIGTAKQAMIAREGDLLTRERLCCGLSIFEVILNRVKSYLDDPVWCGPPPANGIIHVDECSEFHRLWSALQFVYCIPVRGTEYTIEELFGEGLNWAGCVMIVLLGQQRRFEALDFCYHILRVQRVDGKDEDVKGIQLKRMVDRIRRFQVLNSQIFSILNKYLKGGDGEGSNVEHVRCFPPPQHPSVISSSSHYQDPQKLRQSINN DIP protein Q9VF87 original sequence version: 62 F3E4254BAD41015B q7z738_human PCDH12 protein protein human Homo sapiens Human MMQLLQLLLGLLGPGGYLFLLGDCQEVTTLTVKYQVSEEVPSGTVIGKLSQELGREERRRQAGAAFQVLQLPQALPIQVDSEEGLLSTGRRLDREQLCRQWDPCLVSFDVLATGDLALIHVEIQVLDINDHQPRFPKGEQELEISESASLRTRIPLDRALDPDTGPNTLHTYTLSPSEHFALDVIVGPDETKHAELIVVKELDREIHSFFDLVLTAYDNGNPPKSGTSLVKVNVLDSNDNSPAFAESSLALEIQEDAAPGTLLIKLTATDPDQGPNGEVEFFLSKHMPPEVLDTFSIDAKTGQVILRRPLDYEKNPAYEVDVQARDLGPNPIPAHCKVLIKVLDVNDNIPSIHVTWASQPSLVSEALPKDSFIALVMADDLDSGNNGLVHCWLSQELGHFRLKRTNGNTYMLLTNATLDREQWPKYTLTLLAQDQGLQPLSAKKQLSIQISDINDNAPVFEKSRYEVSTRENNLPSLHLITIKAHDADLGINGKVSYRIQDSPVAHLVAIDSNTGEVTAQRSLNYEEMAGFEFQVIAEDSGQPMLASSVSVWVSLLDANDNAPEVVQPVLSDGKASLSVLVNASTGHLLVPIETPNGLGPAGTDTPPLATHSSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNVTNASSLIGSEWELEIVVEDQGSPPLQTRALLRVMFVTSVDHLRDSARKPGALSMSMLTVICLAVLLGIFGLILALFMSICRTEKKDNRAYNCREAESTYRQQPKRPQKHIQKADIHLVPVLRGQAGEPCEVGQSHKDVDKEAMMEAGWDPCLQAPFHLTPTLYRTLRNQGNQGAPAESREVLQDTVNLLFNHPRQRNASRENLNLPEPQPATGQPRSRPLKVAGSPTGRLAGDQGSEEAPQRPPASSATLRRQRHLNGKVSPEKESGPRQILRSLVRLSVAAFAERNPVEELTVDSPPVQQISQLLSLLHQGQFQPKPNHRGNKYLAKPGGSRSAIPDTDGPSARAGGQTDPEQEEGPLDPEEDLSVKQLLEEELSSLLDPSTGLALDRLSAPDPAWMARLSLPLTTNYRDNVISPDAAATEEPRTFQTFGKAEAPELSPTGTRLASTFVSEMSSLLEMLLEQRSSMPVEAASEALRRLSVCGRTLSLDLATSAASGMKVQGDPGGKTGTEGKSRGSSSSSSSSRCL 33522AF445D400EA q9y0s9_drome Abi Abi-1 Ablphilin Dmel\CG9749 abi dAbi Dmel_CG9749 CG9749 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MLTETPMASENIMDELASLIRTEIPDGRQSLRDSYTNLERVADYCEDTYYRADNKKAALEATKNYTTQSLASVAYQINTLAYSYMQLLELQAQQLGEMESQMNHIAQTVHIHKEKVARREIGVLTANKVSSRQFKIVAPINPEKPIKYVRKPIDYSMLDEIGHGINSAQHSQVRQKHRGSSHGSVQSLLPPSVGPPPTTKPPTPPQMSRAGNTGTLGKSVSNTGTLGKSSREYRTPPVVNPPQVPSHYAPNYPIGHPKRMSTASSTMTTTTTGGGAAGNERAAGYSALPMPPSQQIATHVNLPSAGMMQSLPPPPPTTYDDRSSMPPAPPSPLTVSQHEMTEQSHIGMHTLGRNINRNHFSLNFARPGSQSPPLPPPPPPEDEHQDFGRPRTSTGPQLAPIVPEDQNLPGWVPKNFIEKVVAIYDYYADKDDELSFQESSVLYVLKKNDDGWWEGVMDGVTGLFPGNYVEPCV DIP protein Q9Y0S9 original sequence version: 82 5C60813E4100252E robo1_human Roundabout homolog 1 ROBO1 DUTT1 H-Robo-1 Deleted in U twenty twenty protein protein human Homo sapiens Human MKWKHVPFLVMISLLSLSPNHLFLAQLIPDPEDVERGNDHGTPIPTSDNDDNSLGYTGSRLRQEDFPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRKSRPDEGVYVCVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMVAVGEPAVMECQPPRGHPEPTISWKKDGSPLDDKDERITIRGGKLMITYTRKSDAGKYVCVGTNMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSAEFKCEARGDPVPTVRWRKDDGELPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGKAEASATLTVQEPPHFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQRSDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQGPVNQTVAVDGTFVLSCVATGSPVPTILWRKDGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGATPTSYIIEAFSHASGSSWQTVAENVKTETSAIKGLKPNAIYLFLVRAANAYGISDPSQISDPVKTQDVLPTSQGVDHKQVQRELGNAVLHLHNPTVLSSSSIEVHWTVDQQSQYIQGYKILYRPSGANHGESDWLVFEVRTPAKNSVVIPDLRKGVNYEIKARPFFNEFQGADSEIKFAKTLEEAPSAPPQGVTVSKNDGNGTAILVSWQPPPEDTQNGMVQEYKVWCLGNETRYHINKTVDGSTFSVVIPFLVPGIRYSVEVAASTGAGSGVKSEPQFIQLDAHGNPVSPEDQVSLAQQISDVVKQPAFIAGIGAACWIILMVFSIWLYRHRKKRNGLTSTYAGIRKVPSFTFTPTVTYQRGGEAVSSGGRPGLLNISEPAAQPWLADTWPNTGNNHNDCSISCCTAGNGNSDSNLTTYSRPADCIANYNNQLDNKQTNLMLPESTVYGDVDLSNKINEMKTFNSPNLKDGRFVNPSGQPTPYATTQLIQSNLSNNMNNGSGDSGEKHWKPLGQQKQEVAPVQYNIVEQNKLNKDYRANDTVPPTIPYNQSYDQNTGGSYNSSDRGSSTSGSQGHKKGARTPKVPKQGGMNWADLLPPPPAHPPPHSNSEEYNISVDESYDQEMPCPVPPARMYLQQDELEEEEDERGPTPPVRGAASSPAAVSYSHQSTATLTPSPQEELQPMLQDCPEETGHMQHQPDRRRQPVSPPPPPRPISPPHTYGYISGPLVSDMDTDAPEEEEDEADMEVAKMQTRRLLLRGLEQTPASSVGDLESSVTGSMINGWGSASEEDNISSGRSSVSSSDGSFFTDADFAQAVAAAAEYAGLKVARRQMQDAAGRRHFHASQCPRPTSPVSTDSNMSAAVMQKTRPAKKLKHQPGHLRRETYTDDLPPPPVPPPAIKSPTAQSKTQLEVRPVVVPKLPSMDARTDRSSDRKGSSYKGREVLDGRQVVDMRTNPGDPREAQEQQNDGKGRGNKAAKRDLPPAKTHLIQEDILPYCRPTFPTSNNPRDPSSSSSMSSRGSGSRQREQANVGRRNIAEMQVLGGYERGEDNNEELEETES DIP protein Q9Y6N7 original sequence version: 68 DIP protein Q9Y6N7 original sequence version: 86 DIP protein Q9Y6N7 original sequence version: 142 DIP protein Q9Y6N7-1 original sequence version: 144 9D98CD7CAB73074D hem_drome Membrane-associated protein Hem Hem HEM2 CG5837 dHem-2 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MARPIFPNQQKIAEKLIILNDRGLGILTRIYNIKKACGDTKSKPGFLSEKSLESSIKFIVKRFPNIDVKGLNAIVNIKAEIIKSLSLYYHTFVDLLDFKDNVCELLTTMDACQIHLDITLNFELTKYYLDLVVTYVSLMIVLSRVEDRKAVLGLYNAAYELQNNQADTGFPRLGQMILDYEVPLKKLAEEFIPHQRLLTSALRSLTSIYALRNLPADKWREMQKLSLVGNPAILLKAVRTDTMSCEYISLEAMDRWIIFGLLLNHQMLGQYPEVNKIWLSALESSWVVALFRDEVLQIHQYIQATFDGIKGYSKRIGEVKEAYNTAVQKAALMHRERRKFLRTALKELALIMTDQPGLLGPKAIFIFIGLCLARDEILWLLRHNDNPPLLKNKGKSNEDLVDRQLPELLFHMEELRALVRKYSQVMQRYYVQYLSGFDATDLNIRMQSLQMCPEDESIIFSSLYNTAAALTVKQVEDNELFYFRPFRLDWFRLQTYMSVGKAALRIAEHAELARLLDSMVFHTRVVDNLDEILVETSDLSIFCFYNKMFDDQFHMCLEFPAQNRYIIAFPLICSHFQNCTHEMCPEERHHIRERSLSVVNIFLEEMAKEAKNIITTICDEQCTMADALLPKHCAKILSVQSARKKKDKSKSKHFDDIRKPGDESYRKTREDLTTMDKLHMALTELCFAINYCPTVNVWEFAFAPREYLCQNLEHRFSRDLVGMVMFNQETMEIAKPSELLASVRAYMNVLQTVENYVHIDITRVFNNCLLQQTQALDSHGEKTIAALYNTWYSEVLLRRVSAGNIVFSINQKAFVPISPEGWVPFNPQEFSDLNELRALAELVGPYGIKTLNETLMWHIANQVQELKSLVSTNKEVLITLRTSFDKPEVMKEQFKRLQDVDRVLQRMTIIGVIICFRNLVHEALVDVLDKRIPFLLSSVKDFQEHLPGGDQIRVASEMASAAGLLCKVDPTLATTLKSKKPEFDEGEHLTACLLMVFVAVSIPKLARNENSFYRATIDGHSNNTHCMAAAINNIFGALFTICGQSDMEDRMKEFLALASSSLLRLGQESDKEATRNRESIYLLLDEIVKQSPFLTMDLLESCFPYVLIRNAYHGVYKQEQILGLAL 125FE7177AECC0E5 abi2-brk1 1 21 unspecified role unspecified role prey prey trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 18 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role bait bait purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 28 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection association association Fig. 1C, 2G Q7L576 mutations Tyr923Ala, Glu1084Ala, Leu1090Ala and Q9NYB9 Arg106Ala, Arg106Met and Gly116Trp disrupt binding of PCDH10 to the WAVE complex. brk1-abi2 1 21 unspecified role unspecified role prey prey trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 18 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role bait bait purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection association association Fig. 1C brk1-abi2-2 1 21 unspecified role unspecified role prey prey trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 28 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role bait bait purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection association association Fig. 1C brk1-abi2-3 7 21 unspecified role unspecified role neutral component neutral component trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 26 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role neutral component neutral component purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 28 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role neutral component neutral component spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association Supp. Fig. 1A Figure legend suggests murine PCDH10 was used but the sequence length only matches the human table in Supp. Table 3. Origin of construct has been inferred from sequence length. brk1-abi2-4 3 21 unspecified role unspecified role neutral component neutral component purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 23 unspecified role unspecified role neutral component neutral component purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 28 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role neutral component neutral component purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association Supp. Fig. 1B The Kd for PCDH10 binding to the WAVE complex is 2.9E-5M. I've not added the Kd as a paraameter as it relates to PCDH10 bidning to WAVE complex, not assembly of the 6 components. brk1-abi2-5 2 21 unspecified role unspecified role neutral component neutral component purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 28 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain met-1000 se(s)met L-selenomethionine Delta:S(-1)Se(1) Se(S)Met Selenium replaces sulphur semetm certain certain sequence position certain certain certain sequence position certain Q9P2E7:p.Phe1000Met mutation mutation certain certain sequence position certain certain certain sequence position certain F M Wed May 02 15:35:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe1000met' Tue Jun 30 17:27:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe1000Met' ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role neutral component neutral component purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role neutral component neutral component purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association Supp. Table 1 2.43A R-factor working: 18.94%, Free R-factor: 20.89% abi2-brk1-1 1 21 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 18 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role prey prey purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 28 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association Fig. 2F The Kd for PCDH10 binding to the WAVE complex is 2.9E-5M. I've not added the Kd as a paraameter as it relates to PCDH10 bidning to WAVE complex, not assembly of the 6 components. hspc300-abi 1 14 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role bait bait purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 29 unspecified role unspecified role prey prey purified purified spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 33 unspecified role unspecified role prey prey trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 31 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) association association Fig. 3d hspc300-abi-1 1 31 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 33 unspecified role unspecified role prey prey trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 29 unspecified role unspecified role prey prey purified purified spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 8 unspecified role unspecified role bait bait purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 28 unspecified role unspecified role prey prey n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) association association Fig. 3d Mutation of Q9Y0S9 Arg118Ala/Gly122Trp or Q9P2E7 Thr1002Ala/Phe1003Ala) disrupted binding of human GST-PCDH10 to the drosophila WAVE complex. brk1-abi2-7 1 21 unspecified role unspecified role prey prey trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 15 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role bait bait purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 18 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) association association Fig. 4B, Supp. Fig. 3C, Supp. Table 2 WIRS ligand proteins did not bind to WAVE complexes containing Arg106Ala/Gly110Trp-Abi2. Neuroligin-1 with a Thr816Ala/Phe817Ala mutation did not bind the WAVE complex. brk1-abi2-8 1 21 unspecified role unspecified role prey prey trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 26 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role bait bait purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection association association Fig. 4B, Supp. Table 2 WIRS ligand proteins did not bind to WAVE complexes containing Arg106Ala/Gly110Trp-Abi2 brk1-abi2-9 1 21 unspecified role unspecified role prey prey trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 23 unspecified role unspecified role bait bait purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 32 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection association association Fig. 4B, Supp Table 2 WIRS ligand proteins did not bind to WAVE complexes containing Arg106Ala/Gly110Trp-Abi2 brk1-abi2-10 1 21 unspecified role unspecified role prey prey trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 18 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role bait bait purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 19 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection association association Fig. 4B, Supp Table 2 WIRS ligand proteins did not bind to WAVE complexes containing Arg106Ala/Gly110Trp-Abi2 brk1-abi2-11 1 21 unspecified role unspecified role prey prey trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 27 unspecified role unspecified role prey prey n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 18 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role bait bait purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) association association Fig. 4B, Supp Table 2 WIRS ligand proteins did not bind to WAVE complexes containing Arg106Ala/Gly110Trp-Abi2 brk1-abi2-12 1 21 unspecified role unspecified role prey prey trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 18 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 22 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role bait bait purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection association association Fig. 4B, Supp Table 2 WIRS ligand proteins did not bind to WAVE complexes containing Arg106Ala/Gly110Trp-Abi2 brk1-abi2-14 1 21 unspecified role unspecified role prey prey trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 28 competitor competitor competitor prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 28 unspecified role unspecified role prey prey n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 18 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role bait bait purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) association association Fig. 1D A peptide containing this sequence RSFSTFGKE directly bound the WRC and blocked the interaction with PCDH10 CT. The interaction was specifically abolished by mutation of the conserved threonine to alanine. brk1-abi2-16 1 21 unspecified role unspecified role prey prey trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 9 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role bait bait purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 18 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) association association Fig. 1E Systematic introduction of point mutations to the PCDH10 C-Terminal throughout this conserved sequence and measured binding of the mutant proteins to the WRC. The results identified a weak six residue consensus motif, Y-x-T/S-F-X-X (Y = preference for bulky hydrophobic residues; x = any residue; the X-X positions can accommodate single substitutions, but not all combinations of double substitutions brk1-abi2-17 1 21 unspecified role unspecified role prey prey trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 18 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role bait bait purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 28 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) association association Fig. 4B, Supp. Figure 3A, Supp. Table 2 WIRS ligand proteins did not bind to WAVE complexes containing Arg106Ala/Gly110Trp-Abi2. PCDH10 with a Thr1002Ala/Phe1003Alal did not bind to the WAVE complex. brk1-abi2-18 1 21 unspecified role unspecified role prey prey trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 23 unspecified role unspecified role bait bait purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 30 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection association association Fig. 4B, Supp. Table 2 WIRS ligand proteins did not bind to WAVE complexes containing Arg106Ala/Gly110Trp-Abi2 TrEMBL entry used for this as coordinates of fragment are longer than SP entry. brk1-abi2-19 1 21 unspecified role unspecified role prey prey trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 26 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 18 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role bait bait purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) association association Fig. 4B, SUpp. Fig. 3B, Supp. Table 2 WIRS ligand proteins did not bind to WAVE complexes containing Arg106Ala/Gly110Trp-Abi2. PDCH17 with a Thr1000Ala/Phe1001Ala mutation did not bind to the WAVE complex. brk1-abi2-20 1 21 unspecified role unspecified role prey prey trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 23 unspecified role unspecified role bait bait purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 11 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) association association Fig. 4B, Supp. Table 2 WIRS ligand proteins did not bind to WAVE complexes containing Arg106Ala/Gly110Trp-Abi2 brk1-abi2-21 1 21 unspecified role unspecified role prey prey trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 13 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 18 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 25 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role bait bait purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) association association Fig. 4B, Supp. Table 2 WIRS ligand proteins did not bind to WAVE complexes containing Arg106Ala/Gly110Trp-Abi2 brk1-abi2-22 1 21 unspecified role unspecified role prey prey trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 23 unspecified role unspecified role bait bait purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 26 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 24 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) association association Fig. 4B, Supp. Table 2 WIRS ligand proteins did not bind to WAVE complexes containing Arg106Ala/Gly110Trp-Abi2 brk1-abi2-23 1 21 unspecified role unspecified role prey prey trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 26 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role bait bait purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role prey prey n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection association association Fig. 4B, Supp. Table 2 WIRS ligand proteins did not bind to WAVE complexes containing Arg106Ala/Gly110Trp-Abi2 pcdh10-cyfip1-1 4 9 competitor competitor competitor prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse-brain Mus musculus brain brain Brain [cerebrum] 9 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey mouse-brain Mus musculus brain brain Brain [cerebrum] 17 unspecified role unspecified role prey prey mouse-brain Mus musculus brain brain Brain [cerebrum] association association Fig. 6A Addition of the WIRS peptide in this reaction completely blocked the interaction, whereas a peptide with a disrupted WIRS motif had no effect. wasf1-pcdh10 5 17 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Fig. 6B The interaction was weakened by the PDCH10 WIRS peptide whereas the peptide with a disrupted WIRS motif had a lesser effect. abi2-brk1-2 6 21 unspecified role unspecified role neutral component neutral component purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 28 unspecified role unspecified role neutral component neutral component region fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 13 unspecified role unspecified role neutral component neutral component purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 26 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role neutral component neutral component purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 12 competitor competitor competitor neutral component neutral component n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Supp. Fig. 3E The Kd for the displacement of prebound PCDH10 from the WAVE complex by PCDH17 is 1.1E-7M. abi2-brk1-3 6 21 unspecified role unspecified role neutral component neutral component purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 13 unspecified role unspecified role neutral component neutral component purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 28 unspecified role unspecified role neutral component neutral component region fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 18 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 28 competitor competitor competitor neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role neutral component neutral component purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Supp. Fig. 3E The Kd for the displacement of prebound PCDH10 from the WAVE complex by PCDH10 is 8E-8M. PCDH10 Phe1000Ala/Thr1002Ala/Phe1003Ala did not displace the peptide. abi2-brk1-4 6 21 unspecified role unspecified role neutral component neutral component purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 13 unspecified role unspecified role neutral component neutral component purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 18 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role neutral component neutral component purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 28 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Supp. Fig. 3D The Kd for the binding of PCDH10 to the WAVE complex is 2.7E-6M. abi2-brk1-5 6 21 unspecified role unspecified role neutral component neutral component purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 15 competitor competitor competitor neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal nusa tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role neutral component neutral component purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 28 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 18 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role neutral component neutral component purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association Supp. Fig. 3E The Kd for the displacement of prebound PCDH10 from the WAVE complex by Neuroligin-1 is 1.85E-6M. Thr816Ala/Phe817Ala did not displace the peptide. pcdh10-cyfip1-2 4 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey mouse-brain Mus musculus brain brain Brain [cerebrum] 17 unspecified role unspecified role prey prey mouse-brain Mus musculus brain brain Brain [cerebrum] association association Fig. 6A Addition of the WIRS peptide in this reaction completely blocked the interaction, whereas a peptide with a disrupted WIRS motif had no effect.