MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Direct association of the unique C-terminal tail of transmembrane AMPA receptor regulatory protein (TARP) γ-8 with calcineurin. Direct association of the unique C-terminal tail of transmembrane AMPA receptor regulatory protein (TARP) γ-8 with calcineurin. FEBS J. (1742-464X) 2014 imex curation Itakura M., Watanabe I., Sugaya T., Takahashi M. mitakura@med.kitasato-u.ac.jp 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions rat-hippocampus Rattus norvegicus hippocampal neurons hippocampus Hippocampus [Brain hippocampus] fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining mitakura@med.kitasato-u.ac.jp Accepted 2014-JAN-17 by LUANA 2014 imex curation Direct association of the unique C-terminal tail of transmembrane AMPA receptor regulatory protein (TARP) γ-8 with calcineurin. Direct association of the unique C-terminal tail of transmembrane AMPA receptor regulatory protein (TARP) γ-8 with calcineurin. FEBS J. (1742-464X) 2014 imex curation Itakura M., Watanabe I., Sugaya T., Takahashi M. mitakura@med.kitasato-u.ac.jp 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot mitakura@med.kitasato-u.ac.jp Accepted 2014-JAN-17 by LUANA 2014 imex curation Direct association of the unique C-terminal tail of transmembrane AMPA receptor regulatory protein (TARP) γ-8 with calcineurin. Direct association of the unique C-terminal tail of transmembrane AMPA receptor regulatory protein (TARP) γ-8 with calcineurin. FEBS J. (1742-464X) 2014 imex curation Itakura M., Watanabe I., Sugaya T., Takahashi M. mitakura@med.kitasato-u.ac.jp 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions rat-hippocampus Rattus norvegicus hippocampal neurons hippocampus Hippocampus [Brain hippocampus] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot mitakura@med.kitasato-u.ac.jp Accepted 2014-JAN-17 by LUANA 2014 imex curation Direct association of the unique C-terminal tail of transmembrane AMPA receptor regulatory protein (TARP) γ-8 with calcineurin. Direct association of the unique C-terminal tail of transmembrane AMPA receptor regulatory protein (TARP) γ-8 with calcineurin. FEBS J. (1742-464X) 2014 imex curation Itakura M., Watanabe I., Sugaya T., Takahashi M. mitakura@med.kitasato-u.ac.jp 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot mitakura@med.kitasato-u.ac.jp Accepted 2014-JAN-17 by LUANA 2014 imex curation Direct association of the unique C-terminal tail of transmembrane AMPA receptor regulatory protein (TARP) γ-8 with calcineurin. Direct association of the unique C-terminal tail of transmembrane AMPA receptor regulatory protein (TARP) γ-8 with calcineurin. FEBS J. (1742-464X) 2014 imex curation Itakura M., Watanabe I., Sugaya T., Takahashi M. mitakura@med.kitasato-u.ac.jp 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions rat-hippocampus Rattus norvegicus hippocampal neurons hippocampus Hippocampus [Brain hippocampus] anti bait coip anti bait coimmunoprecipitation anti bait coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence mitakura@med.kitasato-u.ac.jp Accepted 2014-JAN-17 by LUANA 2014 imex curation tba1a_rat Tubulin alpha-1A chain Tuba1a Tuba1 Tubulin alpha-1 chain Alpha-tubulin 1 protein protein rat Rattus norvegicus (Rat) Rat MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY 00F8429A4A10E5FE gria2_rat Glutamate receptor 2 Gria2 Glur2 GluR-B GluR-K2 Glutamate receptor ionotropic, AMPA 2 AMPA-selective glutamate receptor 2 protein protein rat Rattus norvegicus (Rat) Rat MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI DIP protein P19491 original sequence version: 164 DIP protein P19491 original sequence version: 160 DIP protein P19491 original sequence version: 131 DIP protein P19491 original sequence version: 136 DIP protein P19491 original sequence version: 141 DEFA817027C1CCD1 canb1_rat Calcineurin subunit B type 1 Ppp3r1 Cna2 Cnb Protein phosphatase 2B regulatory subunit 1 Protein phosphatase 3 regulatory subunit B alpha isoform 1 protein protein rat Rattus norvegicus (Rat) Rat MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV C904715DC0386056 pp2ba_human Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform PPP3CA CALNA CNA Calmodulin-dependent calcineurin A subunit alpha isoform CAM-PRP catalytic subunit protein protein human Homo sapiens Human MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ 16480D62DDBF1F40 pp2ba_rat Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform Ppp3ca Calna Calmodulin-dependent calcineurin A subunit alpha isoform CAM-PRP catalytic subunit protein protein rat Rattus norvegicus (Rat) Rat MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNSSNIQ mint Calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin. Dephosphorylates HSPB1. May also dephosphorylate and activate SSH1 16530C27DDBF1F05 ccg2_rat Voltage-dependent calcium channel gamma-2 subunit Cacng2 Neuronal voltage-gated calcium channel gamma-2 subunit Transmembrane AMPAR regulatory protein gamma-2 Stargazin Stg protein protein rat Rattus norvegicus (Rat) Rat MGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTHSGLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGLCIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSFYFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSSSRSTEPSHSRDASPVGVKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVHNCIQKDSKDSLHANTANRRTTPV DIP protein Q71RJ2 original sequence version: 44 DIP protein Q71RJ2 original sequence version: 53 mint AA9D475606A0FBA4 ccg8_rat Voltage-dependent calcium channel gamma-8 subunit Cacng8 Neuronal voltage-gated calcium channel gamma-8 subunit Transmembrane AMPAR regulatory protein gamma-8 protein protein rat Rattus norvegicus (Rat) Rat MESLKRWNEERGLWCEKGVQVLLTTIGAFAAFGLMTIAISTDYWLYTRALICNTTNLTAGDDGPPHRGGSGSSEKKDPGGLTHSGLWRICCLEGLKRGVCVKINHFPEDTDYDHDSAEYLLRVVRASSIFPILSAILLLLGGVCVAASRVYKSKRNIILGAGILFVAAGLSNIIGVIVYISANAGEPGPKRDEEKKNHYSYGWSFYFGGLSFILAEVIGVLAVNIYIERSREAHCQSRSDLLKAGGGAGGSGGSGPSAILRLPSYRFRYRRRSRSSSRGSSEASPSRDASPGGPGGPGFASTDISMYTLSRDPSKGSVAAGLASAGGGGGGAGVGAYGGAAGAAGGGGTGSERDRGSSAGFLTLHNAFPKEAASGVTVTVTGPPAAPAPAPPAPAAPAPGTLSKEAAASNTNTLNRKTTPV 0FDB1461BDC780A9 tbb_pneca Tubulin beta chain TUB-B Beta-tubulin protein protein pneca Pneumocystis carinii MREIVHLQTGQCGNQIGASFWSTISGEHGLDSTGVYQGTSDLQLERMNVYFNEASGGKYVPRSILIDLEPGTMDAVRSGPFGNLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRREAEACDCLQGFQITHSLGGGTGAGMGTLLISKIREEYPDRMMATFSVVPSPKVSDTVVEPYNATLSVHQLVENSDETFCIDNEALYDICMRTLKLPDPGYGDLNHLVSAVMSGITTCLRFPGQLNSDLRKLAVNMVPFPRLHFFIVGFAPLTSKGSHSFRSLTVPELTQQMFDAKNMMAASDPRHGRYLTVAAIFRGRVSMKEVEDQMHSVQQKNSSYFVEWIPNNVQTALCSIPPRGLKMSSTFIGNSTSIQELFKRVGDQFSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYEIAGVDEEVELDDEIET 9A26706E1B6487F7 dlg4_rat Disks large homolog 4 Dlg4 Dlgh4 Postsynaptic density protein 95 Synapse-associated protein 90 Psd95 protein protein rat Rattus norvegicus (Rat) Rat MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDAGDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL DIP protein P31016 original sequence version: 86 DIP protein P31016-1 original sequence version: 148 7922D4E8E0F9AD85 gria1_rat Glutamate receptor 1 Gria1 GluR-A GluR-K1 Glutamate receptor ionotropic, AMPA 1 AMPA-selective glutamate receptor 1 Glur1 protein protein rat Rattus norvegicus (Rat) Rat MPYIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQIDIVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPARIMQQWRTSDSRDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFCLIPQQSINEAIRTSTLPRNSGAGASGGGGSGENGRVVSQDFPKSMQSIPCMSHSSGMPLGATGL DIP protein P19490 original sequence version: 146 DIP protein P19490 original sequence version: 142 DIP protein P19490 original sequence version: 117 DIP protein P19490 original sequence version: 127 DIP protein P19490 original sequence version: 131 DIP protein P19490 original sequence version: 129 2D4CFA7CCD532838 cacng8-ppp3ca 3 Cn A 10 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level gamma-8 12 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F1b cacng8-ppp3ca-1 5 Cn A 10 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level alpha-tubulin 6 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level beta -tubulin 13 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level gamma-8 12 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association F1A cacng8-ppp3ca-4 3 Cn A 10 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level gamma-8 12 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Cn B 8 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association F1c This result was validated with reciprocal co-immunoprecipitation (Fig. 1C), which showed that γ-8 was efficiently co-immunoprecipitated from rat hippocampal P2 with the anti-Cn A antibody, but less efficiently with the anti-Cn B antibody. These results suggest that γ-8 and Cn form a complex in hippocampal neurons, possibly via a direct interaction. ppp3ca-ppp3r1-2 3 Cn A 10 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level gamma-8 12 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Cn B 8 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association F1c This result was validated with reciprocal co-immunoprecipitation (Fig. 1C), which showed that γ-8 was efficiently co-immunoprecipitated from rat hippocampal P2 with the anti-Cn A antibody, but less efficiently with the anti-Cn B antibody. These results suggest that γ-8 and Cn form a complex in hippocampal neurons, possibly via a direct interaction. cacng8-ppp3ca-5 3 Cn A 10 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Cn B 8 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level gamma-8 12 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association F1d This result was validated with reciprocal co-immunoprecipitation (Fig. 1C), which showed that γ-8 was efficiently co-immunoprecipitated from rat hippocampal P2 with the anti-Cn A antibody, but less efficiently with the anti-Cn B antibody. These results suggest that γ-8 and Cn form a complex in hippocampal neurons, possibly via a direct interaction. cacng2-gria2 3 gamma-2 11 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level GluA2 7 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level pser845 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain GluA1 15 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level pser831 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain association association f1e cacng2-gria1 3 GluA2 7 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level pser845 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain gamma-8 12 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level GluA1 15 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level pser831 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain association association f1e cacng8-gria1-1 3 Cn A 10 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Cn B 8 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level gamma-8 12 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level GluA2 7 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level GluA1 15 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association f2 cacng8-dlg4 1 Cn A 10 immunostaining immunostaining immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell gamma-8 12 immunostaining immunostaining immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell PSD-95 14 immunostaining immunostaining immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f3 cacng8-ppp3ca-6 2 gamma-8 12 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Cn A 9 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association f4d cacng8-ppp3ca-7 4 Cn A 9 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined gamma-8 12 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f6a cacng2-dlg4-1 3 gamma-2 11 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PSD-95 14 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association sf1a cacng2-dlg4-2 3 gamma-8 12 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PSD-95 14 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association sf1a