matrixdb Institut de Biologie et de Chimie des Prot\u00c3\u00a9ines, 7, passage du Vercors 69 367 Lyon cedex 07 FRANCE matrixdb@ibcp.fr http://matrixdb.ibcp.fr Biglycan modulates angiogenesis and bone formation during fracture healing. Biglycan modulates angiogenesis and bone formation during fracture healing. Matrix Biol. (0945-053X) 2014 imex curation Berendsen A.D., Pinnow E.L., Maeda A., Brown A.C., McCartney-Francis N., Kram V., Owens R.T., Robey P.G., Holmbeck K., de Castro L.F., Kilts T.M., Young M.F. myoung@dir.nidcr.nih.gov 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Berendsen A.D., Pinnow E.L., Maeda A., Brown A.C., McCartney-Francis N., Kram V., Owens R.T., Robey P.G., Holmbeck K., de Castro L.F., Kilts T.M., Young M.F. myoung@dir.nidcr.nih.gov Accepted 2014-JUL-15 by ORCHARD Matrix Biol. (0945-053X) 2014 Only protein-protein interactions imex curation Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method vegfa_mouse Vascular endothelial growth factor A Vascular permeability factor Vegfa Vegf protein protein mouse Mus musculus Mouse MNFLLSWVHWTLALLLYLHHAKWSQAAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR DIP protein Q00731 original sequence version: 134 B5540B51E4BB6E17 pgs1_human Biglycan SLRR1A Bone/cartilage proteoglycan I PG-S1 BGN protein protein human Homo sapiens Human MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK DIP protein P21810 original sequence version: null BF16F304C5CD3B3E vegfa_mouse-bgn-2 1 7 predetermined predetermined participant predetermined antibody detection identification by antibody antibody detection unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 4 tag perox activity tag visualisation by peroxidase activity tag perox activity antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey ptm dermatan 4-sulfate d-glucuronosyl-d-galactosyl-d-galactosyl-d-xylosyl-l-serine dermatan 4-sulfate D-glucuronosyl-D-galactosyl-D-galactosyl-D-xylosyl-L-serine beta-heparin chondroitin sulfate B dermatan 4-sulfate D-glucuronosyl-D-galactosyl-D-galactosyl-D-xylosyl-L-serine poly[beta-1,4-L-idopyranuronosyl-alpha-1,3-(2-acetamido-2-deoxy-4-sulfate D-galactosyl)]-beta-1,4-D-glucopyranuronosyl-beta-1,3-D-galactosyl-beta-1,3-D-galactosyl-beta-1,4-D-xylosyl-beta-1,3-L-serine predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ptm chondroitin sulfate d-glucuronosyl-d-galactosyl-d-galactosyl-d-xylosyl-l-serine chondroitin sulfate D-glucuronosyl-D-galactosyl-D-galactosyl-D-xylosyl-L-serine chondroitin 4-sulfate (chondroitin sulfate A) chondroitin 6-sulfate (chondroitin sulfate C) chondroitin sulfate D-glucuronosyl-D-galactosyl-D-galactosyl-D-xylosyl-L-serine poly[beta-1,4-D-glucopyranuronosyl-beta-1,3-(2-acetamido-2-deoxy-4-sulfate-D-galactosyl)]-beta-1,4-D-glucopyranuronosyl-beta-1,3-D-galactosyl-beta-1,3-D-galactosyl-beta-1,4-D-xylosyl-beta-1,3-L-serine; poly[beta-1,4-D-glucopyranuronosyl-beta-1,3-(2-acetami undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association Fig 7A vegfa_mouse-bgn-1 1 4 antibody detection identification by antibody antibody detection antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 7 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) physical association physical association Fig. 7B vegfa_mouse-1 Vascular endothelial growth factor A complex Vegfa dimer VEGF-A complex 3 unspecified role unspecified role dimerisation domain direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction mouse Mus musculus Mouse stable complex stable complex biological system reconstruction evidence based on orthology evidence used in manual assertion biological system reconstruction evidence based on orthology evidence used in manual assertion Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Can promote tumor vascularization. Ligand to vascular endothelial growth factor receptor (VGFR-1) complex. Has heparin-binding properties. Homodimer, via disulfide bridges Homodimer created with intact-jami-dbscripts