MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Divergent roles of HDAC1 and HDAC2 in the regulation of epidermal development and tumorigenesis. Divergent roles of HDAC1 and HDAC2 in the regulation of epidermal development and tumorigenesis. EMBO J. (0261-4189) 2013 imex curation Winter M., Moser M.A., Meunier D., Fischer C., Machat G., Mattes K., Lichtenberger B.M., Brunmeir R., Weissmann S., Murko C., Humer C., Meischel T., Brosch G., Matthias P., Sibilia M., Seiser C. christian.seiser@univie.ac.at 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-keratinocyte Mouse Keratinocyte keratinocyte Keratinocyte anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Winter M., Moser M.A., Meunier D., Fischer C., Machat G., Mattes K., Lichtenberger B.M., Brunmeir R., Weissmann S., Murko C., Humer C., Meischel T., Brosch G., Matthias P., Sibilia M., Seiser C. christian.seiser@univie.ac.at Accepted 2014-FEB-18 by MARTA EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation hdac2_mouse Histone deacetylase 2 Hdac2 Yy1bp YY1 transcription factor-binding protein protein protein mouse Mus musculus Mouse MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVAKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDPKGAKSEQLSNP DIP protein P70288 original sequence version: 83 DIP protein P70288 original sequence version: 123 DIP protein P70288 original sequence version: 112 DIP protein P70288 original sequence version: 99 DIP protein P70288 original sequence version: 155 DIP protein P70288 original sequence version: 117 B9843D24A775157C mta2_mouse Metastasis-associated protein MTA2 Mta2 Mta1l1 Metastasis-associated 1-like 1 protein protein mouse Mus musculus Mouse MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILNQYLDKEDCFFYSLVFDPVQKTLLADQGEIRVGCKFQAEIPDRLAEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGAGFQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGAARGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTKLTRLARRMCRDLLQPRRAARRPYAPINANAIKAECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQAPLKPKTPRGTKTPINRNQLTQNRGLGGIMVKRSYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPTLMTVRPPVPLPASSHPASTNEPIVLED DIP protein Q9R190 original sequence version: 108 DIP protein Q9R190 original sequence version: 99 DIP protein Q9R190 original sequence version: 119 DIP protein Q9R190 original sequence version: 138 DIP protein Q9R190 original sequence version: 144 DIP protein Q9R190 original sequence version: 111 88996F779BA6F4D1 rcor1_mouse REST corepressor 1 Rcor1 D12Wsu95e Kiaa0071 Protein CoREST protein protein mouse Mus musculus Mouse MPAMVEKGPEVSGKRRGRNTAASAASAAASAASAAASAAASAGTASASAAAAASAAAAPNNGQNKSLAAAAPNGNSGSNSWEEGSSGSSSDEEHGGGGMRVGPQYQAAVPDFDPAKLARRSQERDNLGMLVWSPNQSLSEAKLDEYIAIAKEKHGYNMEQALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSWKKTRTKTSVMDRHARKQKREREESEDELEETNGSNPVDIEIDPNKESKKEVPPTETVPQVKKEKHSTQAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSIKRQIQNIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKDETNGPANQKPVKSPESSIKIPEEEDEAASVLDVRYASAS DIP protein Q8CFE3 original sequence version: 97 DIP protein Q8CFE3 original sequence version: 86 DIP protein Q8CFE3 original sequence version: 68 7FA2AEA127EA297A sin3a_mouse Paired amphipathic helix protein Sin3a Sin3a Kiaa4126 Transcriptional corepressor Sin3a Histone deacetylase complex subunit Sin3a protein protein mouse Mus musculus Mouse MKRRLDDQESPVYAAQQRRIPGSTEAFSHQHRVLAPAPPVYEAVSETMQSATGIQYSVAPNYQVSAVPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSSQSAPTPAQPAPQPTAAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRPSQNGCQIRRHSGTGATPPVKKKPKLMSLKESSMADASKHGVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLESFPKERATEGIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAPKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEVCVQVTDLYLAENNNGATGGQLNSQTSRSLLESAYQRKAEQLMSDENCFKLMFIQSQGQVQLTVELLDTEEENSDDPVEAERWSDYVERYMSSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGREQQEKEGKEGNSKKTMENVESLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHERVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSINKYRVKYGTVFKAP DIP protein Q60520 original sequence version: 144 DIP protein Q60520 original sequence version: 106 DIP protein Q60520 original sequence version: 115 DIP protein Q60520 original sequence version: 158 80FE378F62ED7CB3 hdac1_mouse Histone deacetylase 1 Hdac1 protein protein mouse Mus musculus Mouse MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein O09106 original sequence version: 147 DIP protein O09106 original sequence version: 87 DIP protein O09106 original sequence version: 131 DIP protein O09106 original sequence version: 119 DIP protein O09106 original sequence version: 106 DIP protein O09106 original sequence version: 144 DIP protein O09106 original sequence version: 146 DIP protein O09106 original sequence version: 161 DIP protein O09106 original sequence version: 167 DIP protein O09106 original sequence version: 169 DIP protein O09106 original sequence version: 124 DIP protein O09106 original sequence version: 134 DIP protein O09106 original sequence version: 103 DIP protein O09106 original sequence version: 122 7F64D3C17F5E4844 sin3a-hdac1-1 1 6 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 2 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association f5e f5g f7i f8i Importantly, co‐repressor associated deacetylase was significantly reduced for Sin3A, NuRD and Co‐REST complexes in HDAC1‐deficient tumours compared to wild‐type tumours (Figures 7H and I) While HDAC1 protein levels were up‐regulated in the absence of HDAC2, total cellular and co‐repressor associated HDAC activities were unchanged in K5‐SOS Hdac2Δ/Δep epidermis (Figures 8D, E, H and I). sin3a-hdac1-2 1 6 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 3 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 2 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association f5e f5g f7i f8i Importantly, co‐repressor associated deacetylase was significantly reduced for Sin3A, NuRD and Co‐REST complexes in HDAC1‐deficient tumours compared to wild‐type tumours (Figures 7H and I) While HDAC1 protein levels were up‐regulated in the absence of HDAC2, total cellular and co‐repressor associated HDAC activities were unchanged in K5‐SOS Hdac2Δ/Δep epidermis (Figures 8D, E, H and I). mta2-hdac1-6 1 2 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 6 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association f5e f5g f7i f8i Importantly, co‐repressor associated deacetylase was significantly reduced for Sin3A, NuRD and Co‐REST complexes in HDAC1‐deficient tumours compared to wild‐type tumours (Figures 7H and I). While HDAC1 protein levels were up‐regulated in the absence of HDAC2, total cellular and co‐repressor associated HDAC activities were unchanged in K5‐SOS Hdac2Δ/Δep epidermis (Figures 8D, E, H and I).