IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Ataxin-3 is a multivalent ligand for the parkin Ubl domain. Ataxin-3 is a multivalent ligand for the parkin Ubl domain. Biochemistry (0006-2960) 2013 imex curation Bai J.J., Safadi S.S., Mercier P., Barber K.R., Shaw G.S. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease the author DID confirm there is an "L" at position 348 - but did not confirm the identity of the protein (I am fairly sure it must be isoform 2) nor did he state if the boundaries of UIM3 domain are residue 348 or 349 - so have entered as ".." in each instance. The author has confirmed that all tags have been removed from human Parkin UBL domain (residues 1-77) -during cloning, and that for the UIM3 domain there is an "L" at position 348, not 349. gshaw1@uwo.ca 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Bai J.J., Safadi S.S., Mercier P., Barber K.R., Shaw G.S. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. the author DID confirm there is an "L" at position 348 - but did not confirm the identity of the protein (I am fairly sure it must be isoform 2) nor did he state if the boundaries of UIM3 domain are residue 348 or 349 - so have entered as ".." in each instance. The author has confirmed that all tags have been removed from human Parkin UBL domain (residues 1-77) -during cloning, and that for the UIM3 domain there is an "L" at position 348, not 349. gshaw1@uwo.ca Accepted 2014-AUG-11 by ORCHARD Biochemistry (0006-2960) 2013 Only protein-protein interactions imex curation prkn_human E3 ubiquitin-protein ligase parkin PRKN PARK2 Parkin RBR E3 ubiquitin-protein ligase Parkinson juvenile disease protein 2 protein protein human Homo sapiens Human MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV DIP protein O60260 original sequence version: 99 DIP protein O60260-1 original sequence version: 145 DIP protein O60260-1 original sequence version: 158 DIP protein O60260 original sequence version: 157 9A8BB802A3FC84C3 p54252-2 Ataxin-3 ATXN3 ATX3 MJD MJD1 SCA3 Machado-Joseph disease protein 1 Spinocerebellar ataxia type 3 protein protein protein human Homo sapiens Human MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIRVQQMHRPKLIGEELAQLKEQRVHKTDLERVLEANDGSGMLDEDEEDLQRALALSRQEIDMEDEEADLRRAIQLSMQGSSRNISQDMTQTSGTNLTSEELRKRREAYFEKQQQKQQQQQQQQQQGDLSGQSSHPCERPATSSGALGSDLGDAMSEEDMLQAAVTMSLETVRNDLKTEGKK 90C3EF73BB26CAFD atxn3-park2 1 2 unspecified role unspecified role neutral component neutral component ubl_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component uim123_regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range ecoli Escherichia coli (strain K12) direct interaction direct interaction 2A/3/5/6 Supp fig 1/4 Each UIM binds weakly with the parkin Ubl domain. atxn3-park2-1 1 3 unspecified role unspecified role neutral component neutral component uim1_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role neutral component neutral component ubl_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 14 direct interaction direct interaction 4i/5, Supp fig 4 Parkin F13, K48, E49, and V67 consistently displayed the largest chemical shift changes upon titration with the ataxin-3 variants. atxn3-park2-2 1 3 unspecified role unspecified role neutral component neutral component uim2_region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ubl_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 4ii, Supp fig 4. Parkin F13, K48, E49, and V67 consistently displayed the largest chemical shift changes upon titration with the ataxin-3 variants. atxn3-park2-3 1 2 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ubl_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component uim3_region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) direct interaction direct interaction 4iii, Supp fig 4 Parkin F13, K48, E49, and V67 consistently displayed the largest chemical shift changes upon titration with the ataxin-3 variants. atxn3-park2-4 1 3 unspecified role unspecified role neutral component neutral component uim1+2_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ubl_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 5 dont know if it is necessary to add this - but it is not shown elsewhere..