IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Proximity ligation assay combined with flow cytometry is a powerful tool for the detection of cytokine receptor dimerization. Proximity ligation assay combined with flow cytometry is a powerful tool for the detection of cytokine receptor dimerization. Cytokine (1043-4666) 2013 imex curation Andersen S.S., Hvid M., Pedersen F.S., Deleuran B. Affinomics - Interactions curated for the Affinomics consortium. sofieselmer@immunology.au.dk 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Andersen S.S., Hvid M., Pedersen F.S., Deleuran B. Affinomics - Interactions curated for the Affinomics consortium. Put as "In vitro" as the interaction is only seen on cell surface (though we dont know the reacting domains) Flow cytometry was used for the detection of heterodimers as well as fluorescence microscopy. sofieselmer@immunology.au.dk Accepted 2014-OCT-07 by ORCHARD Cytokine (1043-4666) 2013 imex curation il7ra_human Interleukin-7 receptor subunit alpha IL7R CDw127 protein protein human Homo sapiens Human MTILGTTFGMVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDPILLTISILSFFSVALLVILACVLWKKRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPESFGRDSSLTCLAGNVSACDAPILSSSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFSLQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ EF50BF2615EEF50C il2rg_human Cytokine receptor common subunit gamma IL2RG p64 gammaC Interleukin-2 receptor subunit gamma protein protein human Homo sapiens Human MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET 3B6215246D610215 il2rg-il7r 1 2 unspecified role unspecified role neutral component neutral component human-hpb-all Homo sapiens hpb-all Human T lymphoblastoid cell line HPB-ALL This cell line has been shown to have been contaminated by Jurkat cells at some unknown point in its usage. 3 unspecified role unspecified role neutral component neutral component human-hpb-all Homo sapiens hpb-all Human T lymphoblastoid cell line HPB-ALL This cell line has been shown to have been contaminated by Jurkat cells at some unknown point in its usage. physical association physical association 1,2