IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Membrane glucocorticoid receptor activation induces proteomic changes aligning with classical glucocorticoid effects. Membrane glucocorticoid receptor activation induces proteomic changes aligning with classical glucocorticoid effects. Mol. Cell Proteomics (1535-9476) 2013 imex curation Vernocchi S., Battello N., Schmitz S., Revets D., Billing A.M., Turner J.D., Muller C.P. Affinomics - Interactions curated for the Affinomics consortium. I have deleted the Expt in Jurkat cells claude.muller@CRP-SANTE.LU 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Vernocchi S., Battello N., Schmitz S., Revets D., Billing A.M., Turner J.D., Muller C.P. Affinomics - Interactions curated for the Affinomics consortium. I have deleted the Expt in Jurkat cells claude.muller@CRP-SANTE.LU Accepted 2014-AUG-05 by ORCHARD Mol. Cell Proteomics (1535-9476) 2013 Only protein-protein interactions imex curation Membrane glucocorticoid receptor activation induces proteomic changes aligning with classical glucocorticoid effects. Membrane glucocorticoid receptor activation induces proteomic changes aligning with classical glucocorticoid effects. Mol. Cell Proteomics (1535-9476) 2013 imex curation Vernocchi S., Battello N., Schmitz S., Revets D., Billing A.M., Turner J.D., Muller C.P. Affinomics - Interactions curated for the Affinomics consortium. I have deleted the Expt in Jurkat cells claude.muller@CRP-SANTE.LU 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Vernocchi S., Battello N., Schmitz S., Revets D., Billing A.M., Turner J.D., Muller C.P. Affinomics - Interactions curated for the Affinomics consortium. I have deleted the Expt in Jurkat cells claude.muller@CRP-SANTE.LU Accepted 2014-AUG-05 by ORCHARD Mol. Cell Proteomics (1535-9476) 2013 Only protein-protein interactions imex curation gcr_human Glucocorticoid receptor Nuclear receptor subfamily 3 group C member 1 NR3C1 GRL protein protein human Homo sapiens Human MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVGSENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK C5C90C9A5DD16AAB cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI DIP protein Q03135 original sequence version: 164 DIP protein Q03135 original sequence version: 119 DIP protein Q03135 original sequence version: 122 DIP protein Q03135-1 original sequence version: 122 DIP protein Q03135 original sequence version: 133 DIP protein Q03135 original sequence version: 155 DIP protein Q03135 original sequence version: 147 2424DE9B5E6521D5 cav1-nr3c1 2 3 unspecified role unspecified role neutral component neutral component unknown_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 4/5 The authors conclude that at least the first 400 amino acids of the membrane bound Glucocorticoid receptor are the product of the NR3C1 gene. cav1-nr3c1-2 1 3 unspecified role unspecified role neutral component neutral component unknown_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 4 The authors conclude that at least the first 400 amino acids of the membrane bound Glucocorticoid receptor are the product of the NR3C1 gene.