UniProt UniProt http://www.uniprot.org Optineurin mediates a negative regulation of Rab8 by the GTPase-activating protein TBC1D17. Optineurin mediates a negative regulation of Rab8 by the GTPase-activating protein TBC1D17. J. Cell. Sci. (0021-9533) 2012 imex curation Vaibhava V., Nagabhushana A., Chalasani M.L., Sudhakar C., Kumari A., Swarup G. Endogen. RAB8A has been mapped according to supplyer information on used antibody. gshyam@ccmb.res.in 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Vaibhava V., Nagabhushana A., Chalasani M.L., Sudhakar C., Kumari A., Swarup G. Endogen. RAB8A has been mapped according to supplyer information on used antibody. gshyam@ccmb.res.in Accepted 2014-JUL-25 by ORCHARD J. Cell. Sci. (0021-9533) 2012 imex curation Optineurin mediates a negative regulation of Rab8 by the GTPase-activating protein TBC1D17. Optineurin mediates a negative regulation of Rab8 by the GTPase-activating protein TBC1D17. J. Cell. Sci. (0021-9533) 2012 imex curation Vaibhava V., Nagabhushana A., Chalasani M.L., Sudhakar C., Kumari A., Swarup G. Endogen. RAB8A has been mapped according to supplyer information on used antibody. gshyam@ccmb.res.in 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Vaibhava V., Nagabhushana A., Chalasani M.L., Sudhakar C., Kumari A., Swarup G. Endogen. RAB8A has been mapped according to supplyer information on used antibody. gshyam@ccmb.res.in Accepted 2014-JUL-25 by ORCHARD J. Cell. Sci. (0021-9533) 2012 imex curation Optineurin mediates a negative regulation of Rab8 by the GTPase-activating protein TBC1D17. Optineurin mediates a negative regulation of Rab8 by the GTPase-activating protein TBC1D17. J. Cell. Sci. (0021-9533) 2012 imex curation Vaibhava V., Nagabhushana A., Chalasani M.L., Sudhakar C., Kumari A., Swarup G. Endogen. RAB8A has been mapped according to supplyer information on used antibody. gshyam@ccmb.res.in 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Vaibhava V., Nagabhushana A., Chalasani M.L., Sudhakar C., Kumari A., Swarup G. Endogen. RAB8A has been mapped according to supplyer information on used antibody. gshyam@ccmb.res.in Accepted 2014-JUL-25 by ORCHARD J. Cell. Sci. (0021-9533) 2012 imex curation Optineurin mediates a negative regulation of Rab8 by the GTPase-activating protein TBC1D17. Optineurin mediates a negative regulation of Rab8 by the GTPase-activating protein TBC1D17. J. Cell. Sci. (0021-9533) 2012 imex curation Vaibhava V., Nagabhushana A., Chalasani M.L., Sudhakar C., Kumari A., Swarup G. Endogen. RAB8A has been mapped according to supplyer information on used antibody. gshyam@ccmb.res.in 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Vaibhava V., Nagabhushana A., Chalasani M.L., Sudhakar C., Kumari A., Swarup G. Endogen. RAB8A has been mapped according to supplyer information on used antibody. gshyam@ccmb.res.in Accepted 2014-JUL-25 by ORCHARD J. Cell. Sci. (0021-9533) 2012 imex curation Optineurin mediates a negative regulation of Rab8 by the GTPase-activating protein TBC1D17. Optineurin mediates a negative regulation of Rab8 by the GTPase-activating protein TBC1D17. J. Cell. Sci. (0021-9533) 2012 imex curation Vaibhava V., Nagabhushana A., Chalasani M.L., Sudhakar C., Kumari A., Swarup G. Endogen. RAB8A has been mapped according to supplyer information on used antibody. gshyam@ccmb.res.in 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vaibhava V., Nagabhushana A., Chalasani M.L., Sudhakar C., Kumari A., Swarup G. Endogen. RAB8A has been mapped according to supplyer information on used antibody. gshyam@ccmb.res.in Accepted 2014-JUL-25 by ORCHARD J. Cell. Sci. (0021-9533) 2012 imex curation Optineurin mediates a negative regulation of Rab8 by the GTPase-activating protein TBC1D17. Optineurin mediates a negative regulation of Rab8 by the GTPase-activating protein TBC1D17. J. Cell. Sci. (0021-9533) 2012 imex curation Vaibhava V., Nagabhushana A., Chalasani M.L., Sudhakar C., Kumari A., Swarup G. Endogen. RAB8A has been mapped according to supplyer information on used antibody. gshyam@ccmb.res.in 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Vaibhava V., Nagabhushana A., Chalasani M.L., Sudhakar C., Kumari A., Swarup G. Endogen. RAB8A has been mapped according to supplyer information on used antibody. gshyam@ccmb.res.in Accepted 2014-JUL-25 by ORCHARD J. Cell. Sci. (0021-9533) 2012 imex curation tfr1_human Transferrin receptor protein 1 TFRC T9 p90 protein protein human Homo sapiens Human MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENADNNTKANVTKPKRCSGSICYGTIAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVLIYMDQTKFPIVNAELSFFGHAHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNMEGDCPSDWKTDSTCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSGVGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFTYINLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIKLTHDVELNLDYERYNSQLLSFVRDLNQYRADIKEMGLSLQWLYSARGDFFRATSRLTTDFGNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHVFWGSGSHTLPALLENLKLRKQNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF DIP protein P02786 original sequence version: 191 DIP protein P02786 original sequence version: 117 DIP protein P02786 original sequence version: 139 DIP protein P02786 original sequence version: 146 DIP protein P02786 original sequence version: 137 DIP protein P02786 original sequence version: 150 DIP protein P02786 original sequence version: 160 DIP protein P02786 original sequence version: 190 C886F14000D90154 tbc17_human TBC1 domain family member 17 TBC1D17 protein protein human Homo sapiens Human MEGAGYRVVFEKGGVYLHTSAKKYQDRDSLIAGVIRVVEKDNDVLLHWAPVEEAGDSTQILFSKKDSSGGDSCASEEEPTFDPDYEPDWAVISTVRPQLCHSEPTRGAEPSCPQGSWAFSVSLGELKSIRRSKPGLSWAYLVLVTQAGGSLPALHFHRGGTRALLRVLSRYLLLASSPQDSRLYLVFPHDSSALSNSFHHLQLFDQDSSNVVSRFLQDPYSTTFSSFSRVTNFFRGALQPQPEGAASDLPPPPDDEPEPGFEVISCVELGPRPTVERGPPVTEEEWARHVGPEGRLQQVPELKNRIFSGGLSPSLRREAWKFLLGYLSWEGTAEEHKAHIRKKTDEYFRMKLQWKSVSPEQERRNSLLHGYRSLIERDVSRTDRTNKFYEGPENPGLGLLNDILLTYCMYHFDLGYVQGMSDLLSPILYVIQNEVDAFWCFCGFMELVQGNFEESQETMKRQLGRLLLLLRVLDPLLCDFLDSQDSGSLCFCFRWLLIWFKREFPFPDVLRLWEVLWTGLPGPNLHLLVACAILDMERDTLMLSGFGSNEILKHINELTMKLSVEDVLTRAEALHRQLTACPELPHNVQEILGLAPPAEPHSPSPTASPLPLSPTRAPPTPPPSTDTAPQPDSSLEILPEEEDEGADS 1C09D2272FA95496 optn_human Optineurin HYPL Optic neuropathy-inducing protein E3-14.7K-interacting protein FIP-2 Huntingtin-interacting protein L Huntingtin yeast partner L NEMO-related protein Transcription factor IIIA-interacting protein OPTN FIP2 GLC1E NRP HIP7 Huntingtin-interacting protein 7 protein protein human Homo sapiens Human MSHQPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQAMKGRFEELSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSERSSEDPTDDSRLPRAEAEQEKDQLRTQVVRLQAEKADLLGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTALSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEGSTEKENDEEKGPETVGSEVEALNLQVTSLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSAIPSELNEKQELVYTNKKLELQVESMLSEIKMEQAKTEDEKSKLTVLQMTHNKLLQEHNNALKTIEELTRKESEKVDRAVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLKENDAFEDGGRQSLMEMQSRHGARTSDSDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII DIP protein Q96CV9 original sequence version: 65 2BAF841BA515AAE2 rab8a_human Ras-related protein Rab-8A Oncogene c-mel RAB8A MEL RAB8 protein protein human Homo sapiens Human MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL DIP protein P61006 original sequence version: 82 DIP protein P61006 original sequence version: 100 DIP protein P61006 original sequence version: 128 DIP protein P61006 original sequence version: 132 AA52DBF54A2CD056 optn-tbc1d17-1 5 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-9636048]The shifted ranges (210-412) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-9636048]210-412 [EBI-9636048]Q96CV9,2 OPTN glu50lys also interacted physical association physical association 1A, S3C, S4B optn-tbc1d17-2 6 8 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait physical association physical association 1C optn-tbc1d17-3 3 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association 1E and F optn-tbc1d17-4 1 8 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q96CV9:p.Glu50Lys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain E K Wed May 02 17:50:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu50lys' Tue Jun 30 18:44:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu50Lys' colocalization colocalization 1G, H, S5A tbc1d17-tfrc 1 8 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component colocalization colocalization S1A Optineurin (HA-tagged optineurin transfected, UniProt AC Q96CV9) enhanced colocalization. tbc1d17-optn 2 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 2A Knock down of optineurin abolishes the interaction. rab8a-tbc1d17 1 10 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Knock down of optineurin decreases interaction. colocalization colocalization 2B and S1C Optineurin (HA-tagged optineurin Uniprot AC Q96CV9 transfected) enhanced the innteraction. tfrc-rab8a 3 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P61006:p.Gln67Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 15:56:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln67leu' Tue Jun 30 18:19:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln67Leu' P61006:p.Thr22Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T N Wed May 02 15:12:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr22asn' Tue Jun 30 18:25:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr22Asn' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association 6B and C Co-transfection of GFP-tagged TBC1D17 (UniProt AC Q9HA65) with arg381ala mutation enhanced interaction. rab8a-tfrc 1 7 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 6D In cells coexpressing TBC1D17 and Rab8, the amount of Rab8 colocalising with TFRC was significantly reduced. Catalitically inactive TBC1D17 (GFP-tagged TBC1D17 Uniprot AC Q9HA65 transfected with a arg381ala mutation) had no effect on the interaction. optn-rab8a-2 1 9 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q96CV9:p.Glu50Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E K Wed May 02 16:36:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu50lys' Tue Jun 30 19:44:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu50Lys' 10 unspecified role unspecified role neutral component neutral component colocalization colocalization 8C rab8a-tfrc-1 1 7 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection P61006:p.Thr22Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T N Wed May 02 16:48:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr22asn' Tue Jun 30 18:12:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr22Asn' region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P61006:p.Gln67Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 14:52:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln67leu' Tue Jun 30 16:02:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln67Leu' colocalization colocalization S3A TBC1D17 (GFP-tagged TBC1D17 Uniprot AC Q9HA65 transfected) with a arg381ala mutation enhanced the innteraction. optn-tbc1d17-5 4 8 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined OPTN glu50lys also interacted physical association physical association 2A Knock down of optineurin abolishes the interaction. rab8a-optn 5 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey Q96CV9:p.Glu50Lys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain E K Wed May 02 15:54:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu50lys' Tue Jun 30 18:22:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu50Lys' UniProt FTId: VAR_021538. dbSNP: rs28939688. Involved in GLC1E (OMIM 1377609. OPTN glu50lys also interacted physical association physical association S6