IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The oncoprotein HBXIP uses two pathways to up-regulate S100A4 in promotion of growth and migration of breast cancer cells. The oncoprotein HBXIP uses two pathways to up-regulate S100A4 in promotion of growth and migration of breast cancer cells. J. Biol. Chem. (0021-9258) 2012 imex curation Liu S., Li L., Zhang Y., Zhang Y., Zhao Y., You X., Lin Z., Zhang X., Ye L. IBD - Inflammatory bowel disease The identity of HBXIP was inferred from previous work of the authors (PMID:21343296). zhlin720@ybu.edu.cn, zhangxd@nankai.edu.cn, yelihong@nankai.edu.cn 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa autoradiography autoradiography Liu S., Li L., Zhang Y., Zhang Y., Zhao Y., You X., Lin Z., Zhang X., Ye L. IBD - Inflammatory bowel disease The identity of HBXIP was inferred from previous work of the authors (PMID:21343296). zhlin720@ybu.edu.cn, zhangxd@nankai.edu.cn, yelihong@nankai.edu.cn Accepted 2014-NOV-17 by ORCHARD J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation The oncoprotein HBXIP uses two pathways to up-regulate S100A4 in promotion of growth and migration of breast cancer cells. The oncoprotein HBXIP uses two pathways to up-regulate S100A4 in promotion of growth and migration of breast cancer cells. J. Biol. Chem. (0021-9258) 2012 imex curation Liu S., Li L., Zhang Y., Zhang Y., Zhao Y., You X., Lin Z., Zhang X., Ye L. IBD - Inflammatory bowel disease The identity of HBXIP was inferred from previous work of the authors (PMID:21343296). zhlin720@ybu.edu.cn, zhangxd@nankai.edu.cn, yelihong@nankai.edu.cn 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Liu S., Li L., Zhang Y., Zhang Y., Zhao Y., You X., Lin Z., Zhang X., Ye L. IBD - Inflammatory bowel disease The identity of HBXIP was inferred from previous work of the authors (PMID:21343296). zhlin720@ybu.edu.cn, zhangxd@nankai.edu.cn, yelihong@nankai.edu.cn Accepted 2014-NOV-17 by ORCHARD J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation The oncoprotein HBXIP uses two pathways to up-regulate S100A4 in promotion of growth and migration of breast cancer cells. The oncoprotein HBXIP uses two pathways to up-regulate S100A4 in promotion of growth and migration of breast cancer cells. J. Biol. Chem. (0021-9258) 2012 imex curation Liu S., Li L., Zhang Y., Zhang Y., Zhao Y., You X., Lin Z., Zhang X., Ye L. IBD - Inflammatory bowel disease The identity of HBXIP was inferred from previous work of the authors (PMID:21343296). zhlin720@ybu.edu.cn, zhangxd@nankai.edu.cn, yelihong@nankai.edu.cn 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu S., Li L., Zhang Y., Zhang Y., Zhao Y., You X., Lin Z., Zhang X., Ye L. IBD - Inflammatory bowel disease The identity of HBXIP was inferred from previous work of the authors (PMID:21343296). zhlin720@ybu.edu.cn, zhangxd@nankai.edu.cn, yelihong@nankai.edu.cn Accepted 2014-NOV-17 by ORCHARD J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation s100a4_human_gene Human S100 calcium binding protein A4 gene gene human Homo sapiens Human stat4_human Signal transducer and activator of transcription 4 STAT4 protein protein human Homo sapiens Human MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILLQNLLIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAANMPVQGPLEKSLQSSSVSERQRNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQTMDQSDKNSAMVNQEVLTLQEMLNSLDFKRKEALSKMTQIIHETDLLMNTMLIEELQDWKRRQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQRTHMLERVTFLIYNLFKNSFVVERQPCMPTHPQRPLVLKTLIQFTVKLRLLIKLPELNYQVKVKASIDKNVSTLSNRRFVLCGTNVKAMSIEESSNGSLSVEFRHLQPKEMKSSAGGKGNEGCHMVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNLVFFNNPPPATLSQLLEVMSWQFSSYVGRGLNSDQLHMLAEKLTVQSSYSDGHLTWAKFCKEHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFSESHLGGITFTWVDHSESGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPHSPSDLLPMSPSVYAVLRENLSPTTIETAMKSPYSAE DIP protein Q14765 original sequence version: 81 11E43803A9AF4FFA ltor5_human Ragulator complex protein LAMTOR5 LAMTOR5 HBXIP Hepatitis B virus X-interacting protein Late endosomal/lysosomal adaptor and MAPK and MTOR activator 5 XIP protein protein human Homo sapiens Human MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS DIP protein O43504 original sequence version: 119 01D9E762ABC63980 s10a4_human_core-s1-1_dna-probe Human S10A4 gene promoter core regulation region S1-1 DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human GTGCTAAAGAGATCCAGATGTGAGATTCTGATGTGGAACT stat4-s100a4 2 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 3c Q14765 increases expression at protein level of ENSG00000196154 Q14765 increases expression at RNA level of ENSG00000196154 lamtor5-s100a4 2 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 2b O43504 increases expression at RNA level of ENSG00000196154 O43504 increases expression at protein level of ENSG00000196154 lamtor5-stat4 3 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Fig. 3d stat4-lamtor5 3 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Fig. 3d s10a4-lamtor5 1 6 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells 7 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 2f, 3b In contrast to HBXIP/LTOR5 present in nuclear cell extracts, purified HBXIP/LTOR5 could not bind to the S1-1 S100A4 promoter DNA probe. s10a4-stat4 1 5 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells 7 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 3b