UniProt UniProt http://www.uniprot.org Cancer-associated loss-of-function mutations implicate DAPK3 as a tumor-suppressing kinase. Cancer-associated loss-of-function mutations implicate DAPK3 as a tumor-suppressing kinase. Cancer Res. (0008-5472) 2011 imex curation Brognard J., Zhang Y.W., Puto L.A., Hunter T. Cancer - Interactions investigated in the context of cancer Origin of GST-MLC2 ( from Dr. Ruey-Hwa Chen) accord. pmid 14600263 hunter@salk.edu 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions human-h157 Homo sapiens H157 oral squamous cell carcinoma cell line h157 H157 human oral squamous cell carcinoma cell line anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Brognard J., Zhang Y.W., Puto L.A., Hunter T. Cancer - Interactions investigated in the context of cancer Origin of GST-MLC2 ( from Dr. Ruey-Hwa Chen) accord. pmid 14600263 hunter@salk.edu Accepted 2014-SEP-01 by ORCHARD Cancer Res. (0008-5472) 2011 imex curation Cancer-associated loss-of-function mutations implicate DAPK3 as a tumor-suppressing kinase. Cancer-associated loss-of-function mutations implicate DAPK3 as a tumor-suppressing kinase. Cancer Res. (0008-5472) 2011 imex curation Brognard J., Zhang Y.W., Puto L.A., Hunter T. Cancer - Interactions investigated in the context of cancer Origin of GST-MLC2 ( from Dr. Ruey-Hwa Chen) accord. pmid 14600263 hunter@salk.edu 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Brognard J., Zhang Y.W., Puto L.A., Hunter T. Cancer - Interactions investigated in the context of cancer Origin of GST-MLC2 ( from Dr. Ruey-Hwa Chen) accord. pmid 14600263 hunter@salk.edu Accepted 2014-SEP-01 by ORCHARD Cancer Res. (0008-5472) 2011 imex curation ml12b_human Myosin regulatory light chain 12B MYL12B MRLC2 Myosin regulatory light chain 2-B, smooth muscle isoform MLC-2A SHUJUN-1 MYLC2B Myosin regulatory light chain MRLC2 Myosin regulatory light chain 20 kDa protein protein human Homo sapiens Human MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD 78FF911630F3870B dapk3_human Death-associated protein kinase 3 DAPK3 ZIPK DAP-like kinase Zipper-interacting protein kinase MYPT1 kinase protein protein human Homo sapiens Human MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREEIEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFLKQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEYFSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTTRLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCHEDVEALAAIYEEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRYEALAKQVASEMRFVQDLVRALEQEKLQGVECGLR 56773008A6A61CF0 dapk3-myl12b-5 2 4 enzyme enzyme neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O43293:p.Thr180Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain T A Wed May 02 17:10:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr180ala' Tue Jun 30 17:32:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr180Ala' O43293:p.Asp161Asn mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain D N Wed May 02 16:54:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp161asn' Tue Jun 30 17:20:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp161Asn' ovarian mucinous carcinoma sample; UniProt FTId: VAR_040439 O43293:p.Pro216Ser mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain P S Wed May 02 16:22:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro216ser' Tue Jun 30 17:28:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro216Ser' lung neuroendocrine carcinoma sample; UniProt FTId: VAR_040440. O43293:p.Thr112Met mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain T M Wed May 02 18:06:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr112met' Tue Jun 30 18:37:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr112Met' colorectal adenocarcinoma sample; UniProt FTId: VAR_040438. human-h157 Homo sapiens H157 oral squamous cell carcinoma cell line h157 H157 human oral squamous cell carcinoma cell line 3 enzyme target enzyme target substrate substrate neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 1E O14950 ser-20 O-phospho-L-serine dapk3-dapk3-2 1 4 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O43293:p.Pro216Ser mutation mutation certain certain sequence position certain certain certain sequence position certain P S Wed May 02 16:11:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro216ser' Tue Jun 30 16:33:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro216Ser' lung neuroendocrine carcinoma sample; UniProt FTId: VAR_040440. O43293:p.Ala116Asn mutation mutation certain certain sequence position certain certain certain sequence position certain A N Wed May 02 17:28:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala116asn' Tue Jun 30 18:03:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala116Asn' ovarian mucinous carcinoma sample; UniProt FTId: VAR_040439 O43293:p.Thr112Met mutation mutation certain certain sequence position certain certain certain sequence position certain T M Wed May 02 17:06:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr112met' Tue Jun 30 15:41:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr112Met' colorectal adenocarcinoma sample; UniProt FTId: VAR_040438. 4 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3C