bhf-ucl The EDD E3 ubiquitin ligase ubiquitinates and up-regulates beta-catenin. The EDD E3 ubiquitin ligase ubiquitinates and up-regulates beta-catenin. Mol. Biol. Cell (1059-1524) 2011 imex curation Hay-Koren A., Caspi M., Zilberberg A., Rosin-Arbesfeld R. Cardiac - Interactions involving cardiac related proteins Flag-EDD is of human origin (PMID: 10030672) The flag tag is n-terminal (PMID: 12594221). EDD, GSK-3beta, Beta-catenin constructs are all of human origin as confirmed by the author. arina@tau.ac.il 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hay-Koren A., Caspi M., Zilberberg A., Rosin-Arbesfeld R. Cardiac - Interactions involving cardiac related proteins Flag-EDD is of human origin (PMID: 10030672) The flag tag is n-terminal (PMID: 12594221). EDD, GSK-3beta, Beta-catenin constructs are all of human origin as confirmed by the author. arina@tau.ac.il Accepted 2014-SEP-29 by MGT Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation The EDD E3 ubiquitin ligase ubiquitinates and up-regulates beta-catenin. The EDD E3 ubiquitin ligase ubiquitinates and up-regulates beta-catenin. Mol. Biol. Cell (1059-1524) 2011 imex curation Hay-Koren A., Caspi M., Zilberberg A., Rosin-Arbesfeld R. Cardiac - Interactions involving cardiac related proteins Flag-EDD is of human origin (PMID: 10030672) The flag tag is n-terminal (PMID: 12594221). EDD, GSK-3beta, Beta-catenin constructs are all of human origin as confirmed by the author. arina@tau.ac.il 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hay-Koren A., Caspi M., Zilberberg A., Rosin-Arbesfeld R. Cardiac - Interactions involving cardiac related proteins Flag-EDD is of human origin (PMID: 10030672) The flag tag is n-terminal (PMID: 12594221). EDD, GSK-3beta, Beta-catenin constructs are all of human origin as confirmed by the author. arina@tau.ac.il Accepted 2014-SEP-29 by MGT Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation The EDD E3 ubiquitin ligase ubiquitinates and up-regulates beta-catenin. The EDD E3 ubiquitin ligase ubiquitinates and up-regulates beta-catenin. Mol. Biol. Cell (1059-1524) 2011 imex curation Hay-Koren A., Caspi M., Zilberberg A., Rosin-Arbesfeld R. Cardiac - Interactions involving cardiac related proteins Flag-EDD is of human origin (PMID: 10030672) The flag tag is n-terminal (PMID: 12594221). EDD, GSK-3beta, Beta-catenin constructs are all of human origin as confirmed by the author. arina@tau.ac.il 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions human-sw480 Human SW480 adenocarcinoma cell line sw480 SW480- human primary colorectal adenocarcinoma cell line There is a G -> A mutation in codon 273 of the p53 gene resulting in an Arg -> His substitution and a C -> T mutation in codon 309 resulting in a Pro -> Ser substitution. http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CCL-228&Template=cellBiology anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hay-Koren A., Caspi M., Zilberberg A., Rosin-Arbesfeld R. Cardiac - Interactions involving cardiac related proteins Flag-EDD is of human origin (PMID: 10030672) The flag tag is n-terminal (PMID: 12594221). EDD, GSK-3beta, Beta-catenin constructs are all of human origin as confirmed by the author. arina@tau.ac.il Accepted 2014-SEP-29 by MGT Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation The EDD E3 ubiquitin ligase ubiquitinates and up-regulates beta-catenin. The EDD E3 ubiquitin ligase ubiquitinates and up-regulates beta-catenin. Mol. Biol. Cell (1059-1524) 2011 imex curation Hay-Koren A., Caspi M., Zilberberg A., Rosin-Arbesfeld R. Cardiac - Interactions involving cardiac related proteins Flag-EDD is of human origin (PMID: 10030672) The flag tag is n-terminal (PMID: 12594221). EDD, GSK-3beta, Beta-catenin constructs are all of human origin as confirmed by the author. arina@tau.ac.il 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hay-Koren A., Caspi M., Zilberberg A., Rosin-Arbesfeld R. Cardiac - Interactions involving cardiac related proteins Flag-EDD is of human origin (PMID: 10030672) The flag tag is n-terminal (PMID: 12594221). EDD, GSK-3beta, Beta-catenin constructs are all of human origin as confirmed by the author. arina@tau.ac.il Accepted 2014-SEP-29 by MGT Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation The EDD E3 ubiquitin ligase ubiquitinates and up-regulates beta-catenin. The EDD E3 ubiquitin ligase ubiquitinates and up-regulates beta-catenin. Mol. Biol. Cell (1059-1524) 2011 imex curation Hay-Koren A., Caspi M., Zilberberg A., Rosin-Arbesfeld R. Cardiac - Interactions involving cardiac related proteins Flag-EDD is of human origin (PMID: 10030672) The flag tag is n-terminal (PMID: 12594221). EDD, GSK-3beta, Beta-catenin constructs are all of human origin as confirmed by the author. arina@tau.ac.il 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hay-Koren A., Caspi M., Zilberberg A., Rosin-Arbesfeld R. Cardiac - Interactions involving cardiac related proteins Flag-EDD is of human origin (PMID: 10030672) The flag tag is n-terminal (PMID: 12594221). EDD, GSK-3beta, Beta-catenin constructs are all of human origin as confirmed by the author. arina@tau.ac.il Accepted 2014-SEP-29 by MGT Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation The EDD E3 ubiquitin ligase ubiquitinates and up-regulates beta-catenin. The EDD E3 ubiquitin ligase ubiquitinates and up-regulates beta-catenin. Mol. Biol. Cell (1059-1524) 2011 imex curation Hay-Koren A., Caspi M., Zilberberg A., Rosin-Arbesfeld R. Cardiac - Interactions involving cardiac related proteins Flag-EDD is of human origin (PMID: 10030672) The flag tag is n-terminal (PMID: 12594221). EDD, GSK-3beta, Beta-catenin constructs are all of human origin as confirmed by the author. arina@tau.ac.il 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Hay-Koren A., Caspi M., Zilberberg A., Rosin-Arbesfeld R. Cardiac - Interactions involving cardiac related proteins Flag-EDD is of human origin (PMID: 10030672) The flag tag is n-terminal (PMID: 12594221). EDD, GSK-3beta, Beta-catenin constructs are all of human origin as confirmed by the author. arina@tau.ac.il Accepted 2014-SEP-29 by MGT Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation The EDD E3 ubiquitin ligase ubiquitinates and up-regulates beta-catenin. The EDD E3 ubiquitin ligase ubiquitinates and up-regulates beta-catenin. Mol. Biol. Cell (1059-1524) 2011 imex curation Hay-Koren A., Caspi M., Zilberberg A., Rosin-Arbesfeld R. Cardiac - Interactions involving cardiac related proteins Flag-EDD is of human origin (PMID: 10030672) The flag tag is n-terminal (PMID: 12594221). EDD, GSK-3beta, Beta-catenin constructs are all of human origin as confirmed by the author. arina@tau.ac.il 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions human-sw480 Human SW480 adenocarcinoma cell line sw480 SW480- human primary colorectal adenocarcinoma cell line There is a G -> A mutation in codon 273 of the p53 gene resulting in an Arg -> His substitution and a C -> T mutation in codon 309 resulting in a Pro -> Ser substitution. http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CCL-228&Template=cellBiology confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Hay-Koren A., Caspi M., Zilberberg A., Rosin-Arbesfeld R. Cardiac - Interactions involving cardiac related proteins Flag-EDD is of human origin (PMID: 10030672) The flag tag is n-terminal (PMID: 12594221). EDD, GSK-3beta, Beta-catenin constructs are all of human origin as confirmed by the author. arina@tau.ac.il Accepted 2014-SEP-29 by MGT Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation The EDD E3 ubiquitin ligase ubiquitinates and up-regulates beta-catenin. The EDD E3 ubiquitin ligase ubiquitinates and up-regulates beta-catenin. Mol. Biol. Cell (1059-1524) 2011 imex curation Hay-Koren A., Caspi M., Zilberberg A., Rosin-Arbesfeld R. Cardiac - Interactions involving cardiac related proteins Flag-EDD is of human origin (PMID: 10030672) The flag tag is n-terminal (PMID: 12594221). EDD, GSK-3beta, Beta-catenin constructs are all of human origin as confirmed by the author. arina@tau.ac.il 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Hay-Koren A., Caspi M., Zilberberg A., Rosin-Arbesfeld R. Cardiac - Interactions involving cardiac related proteins Flag-EDD is of human origin (PMID: 10030672) The flag tag is n-terminal (PMID: 12594221). EDD, GSK-3beta, Beta-catenin constructs are all of human origin as confirmed by the author. arina@tau.ac.il Accepted 2014-SEP-29 by MGT Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation The EDD E3 ubiquitin ligase ubiquitinates and up-regulates beta-catenin. The EDD E3 ubiquitin ligase ubiquitinates and up-regulates beta-catenin. Mol. Biol. Cell (1059-1524) 2011 imex curation Hay-Koren A., Caspi M., Zilberberg A., Rosin-Arbesfeld R. Cardiac - Interactions involving cardiac related proteins Flag-EDD is of human origin (PMID: 10030672) The flag tag is n-terminal (PMID: 12594221). EDD, GSK-3beta, Beta-catenin constructs are all of human origin as confirmed by the author. arina@tau.ac.il 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Hay-Koren A., Caspi M., Zilberberg A., Rosin-Arbesfeld R. Cardiac - Interactions involving cardiac related proteins Flag-EDD is of human origin (PMID: 10030672) The flag tag is n-terminal (PMID: 12594221). EDD, GSK-3beta, Beta-catenin constructs are all of human origin as confirmed by the author. arina@tau.ac.il Accepted 2014-SEP-29 by MGT Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation The EDD E3 ubiquitin ligase ubiquitinates and up-regulates beta-catenin. The EDD E3 ubiquitin ligase ubiquitinates and up-regulates beta-catenin. Mol. Biol. Cell (1059-1524) 2011 imex curation Hay-Koren A., Caspi M., Zilberberg A., Rosin-Arbesfeld R. Cardiac - Interactions involving cardiac related proteins Flag-EDD is of human origin (PMID: 10030672) The flag tag is n-terminal (PMID: 12594221). EDD, GSK-3beta, Beta-catenin constructs are all of human origin as confirmed by the author. arina@tau.ac.il 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Hay-Koren A., Caspi M., Zilberberg A., Rosin-Arbesfeld R. Cardiac - Interactions involving cardiac related proteins Flag-EDD is of human origin (PMID: 10030672) The flag tag is n-terminal (PMID: 12594221). EDD, GSK-3beta, Beta-catenin constructs are all of human origin as confirmed by the author. arina@tau.ac.il Accepted 2014-SEP-29 by MGT Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation The EDD E3 ubiquitin ligase ubiquitinates and up-regulates beta-catenin. The EDD E3 ubiquitin ligase ubiquitinates and up-regulates beta-catenin. Mol. Biol. Cell (1059-1524) 2011 imex curation Hay-Koren A., Caspi M., Zilberberg A., Rosin-Arbesfeld R. Cardiac - Interactions involving cardiac related proteins Flag-EDD is of human origin (PMID: 10030672) The flag tag is n-terminal (PMID: 12594221). EDD, GSK-3beta, Beta-catenin constructs are all of human origin as confirmed by the author. arina@tau.ac.il 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Hay-Koren A., Caspi M., Zilberberg A., Rosin-Arbesfeld R. Cardiac - Interactions involving cardiac related proteins Flag-EDD is of human origin (PMID: 10030672) The flag tag is n-terminal (PMID: 12594221). EDD, GSK-3beta, Beta-catenin constructs are all of human origin as confirmed by the author. arina@tau.ac.il Accepted 2014-SEP-29 by MGT Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation ns1bp_human Influenza virus NS1A-binding protein Aryl hydrocarbon receptor-associated protein 3 IVNS1ABP ARA3 FLARA3 KIAA0850 NS1 NS1BP HSPC068 KLHL39 Kelch-like protein 39 protein protein human Homo sapiens Human MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLKADKELVKDVYSAAKKLKMDRVKQVCGDYLLSRMDVTSCISYRNFASCMGDSRLLNKVDAYIQEHLLQISEEEEFLKLPRLKLEVMLEDNVCLPSNGKLYTKVINWVQRSIWENGDSLEELMEEVQTLYYSADHKLLDGNLLDGQAEVFGSDDDHIQFVQKKPPRENGHKQISSSSTGCLSSPNATVQSPKHEWKIVASEKTSNNTYLCLAVLDGIFCVIFLHGRNSPQSSPTSTPKLSKSLSFEMQQDELIEKPMSPMQYARSGLGTAEMNGKLIAAGGYNREECLRTVECYNPHTDHWSFLAPMRTPRARFQMAVLMGQLYVVGGSNGHSDDLSCGEMYDSNIDDWIPVPELRTNRCNAGVCALNGKLYIVGGSDPYGQKGLKNCDVFDPVTKLWTSCAPLNIRRHQSAVCELGGYLYIIGGAESWNCLNTVERYNPENNTWTLIAPMNVARRGAGVAVLNGKLFVCGGFDGSHAISCVEMYDPTRNEWKMMGNMTSPRSNAGIATVGNTIYAVGGFDGNEFLNTVEVYNLESNEWSPYTKIFQF 456E30DC4E351CCD apc_human Adenomatous polyposis coli protein APC DP2.5 Deleted in polyposis 2.5 protein protein human Homo sapiens Human MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDEAMASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPRRGFVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSLQTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRIARIQQIEKDILRIRQLLQSQATEAERSSQNKHETGSHDAERQNEGQGVGEINMATSGNGQGSTTRMDHETASVLSSSSTHSAPRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLLHGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETCWEWQEAHEPGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQVDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLSPKASHRSKQRHKQSLYGDYVFDTNRHDDNRSDNFNTGNMTVLSPYLNTTVLPSSSSSRGSLDSSRSEKDRSLERERGIGLGNYHPATENPGTSSKRGLQISTTAAQIAKVMEEVSAIHTSQEDRSSGSTTELHCVTDERNALRRSSAAHTHSNTYNFTKSENSNRTCSMPYAKLEYKRSSNDSLNSVSSSDGYGKRGQMKPSIESYSEDDESKFCSYGQYPADLAHKIHSANHMDDNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQSEQRQSRNQSTTYPVYTESTDDKHLKFQPHFGQQECVSPYRSRGANGSETNRVGSNHGINQNVSQSLCQEDDYEDDKPTNYSERYSEEEQHEEEERPTNYSIKYNEEKRHVDQPIDYSLKYATDIPSSQKQSFSFSKSSSGQSSKTEHMSSSSENTSTPSSNAKRQNQLHPSSAQSRSGQPQKAATCKVSSINQETIQTYCVEDTPICFSRCSSLSSLSSAEDEIGCNQTTQEADSANTLQIAEIKEKIGTRSAEDPVSEVPAVSQHPRTKSSRLQGSSLSSESARHKAVEFSSGAKSPSKSGAQTPKSPPEHYVQETPLMFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKTPPPPPQTAQTKREVPKNKAPTAEKRESGPKQAAVNAAVQRVQVLPDADTLLHFATESTPDGFSCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETESEQPKESNENQEKEAEKTIDSEKDLLDDSDDDDIEILEECIISAMPTKSSRKAKKPAQTASKLPPPVARKPSQLPVYKLLPSQNRLQPQKHVSFTPGDDMPRVYCVEGTPINFSTATSLSDLTIESPPNELAAGEGVRGGAQSGEFEKRDTIPTEGRSTDEAQGGKTSSVTIPELDDNKAEEGDILAECINSAMPKGKSHKPFRVKKIMDQVQQASASSSAPNKNQLDGKKKKPTSPVKPIPQNTEYRTRVRKNADSKNNLNAERVFSDNKDSKKQNLKNNSKVFNDKLPNNEDRVRGSFAFDSPHHYTPIEGTPYCFSRNDSLSSLDFDDDDVDLSREKAELRKAKENKESEAKVTSHTELTSNQQSANKTQAIAKQPINRGQPKPILQKQSTFPQSSKDIPDRGAATDEKLQNFAIENTPVCFSHNSSLSSLSDIDQENNNKENEPIKETEPPDSQGEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLQECISSAMPKKKKPSRLKGDNEKHSPRNMGGILGEDLTLDLKDIQRPDSEHGLSPDSENFDWKAIQEGANSIVSSLHQAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEEKPFTSNKGPRILKPGEKSTLETKKIESESKGIKGGKKVYKSLITGKVRSNSEISGQMKQPLQANMPSISRGRTMIHIPGVRNSSSSTSPVSKKGPPLKTPASKSPSEGQTATTSPRGAKPSVKSELSPVARQTSQIGGSSKAPSRSGSRDSTPSRPAQQPLSRPIQSPGRNSISPGRNGISPPNKLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQMSQQNLTKQTGLSKNASSIPRSESASKGLNQMNNGNGANKKVELSRMSSTKSSGSESDRSERPVLVRQSTFIKEAPSPTLRRKLEESASFESLSPSSRPASPTRSQAQTPVLSPSLPDMSLSTHSSVQAGGWRKLPPNLSPTIEYNDGRPAKRHDIARSHSESPSRLPINRSGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSESSEKAKSEDEKHVNSISGTKQSKENQVSAKGTWRKIKENEFSPTNSTSQTVSSGATNGAESKTLIYQMAPAVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDSVSEKANPNIKDSKDNQAKQNVGNGSVPMRTVGLENRLNSFIQVDAPDQKGTEIKPGQNNPVPVSETNESSIVERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVNNNTKKRDSKTDSTESSGTQSPKRHSGSYLVTSV DIP protein P25054 original sequence version: 143 DIP protein P25054-1 original sequence version: 157 DIP protein P25054 original sequence version: 158 77E194AE4A91DC5A gsk3b_human Glycogen synthase kinase-3 beta GSK3B Serine/threonine-protein kinase GSK3B protein protein human Homo sapiens Human MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST DIP protein P49841 original sequence version: 109 DIP protein P49841 original sequence version: 136 DIP protein P49841 original sequence version: 143 DIP protein P49841 original sequence version: 141 DIP protein P49841 original sequence version: 196 DIP protein P49841 original sequence version: 159 DIP protein P49841 original sequence version: 151 4ACC24D00CDBB9C3 ctnb1_human Catenin beta-1 Beta-catenin OK/SW-cl.35 PRO2286 CTNNB1 CTNNB protein protein human Homo sapiens Human MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL DIP protein P35222 original sequence version: 187 DIP protein P35222 original sequence version: 188 DIP protein P35222 original sequence version: 180 DIP protein P35222-1 original sequence version: 181 DIP protein P35222 original sequence version: 181 DIP protein P35222 original sequence version: 107 DIP protein P35222-1 original sequence version: 107 DIP protein P35222 original sequence version: 103 DIP protein P35222-1 original sequence version: 103 DIP protein P35222 original sequence version: 175 DIP protein P35222 original sequence version: 136 DIP protein P35222 original sequence version: 135 DIP protein P35222 original sequence version: 131 DIP protein P35222-1 original sequence version: 133 DIP protein P35222 original sequence version: 133 DIP protein P35222 original sequence version: 148 DIP protein P35222-1 original sequence version: 139 DIP protein P35222 original sequence version: 139 DIP protein P35222 original sequence version: 146 DIP protein P35222 original sequence version: 196 DIP protein P35222 original sequence version: 192 DIP protein P35222 original sequence version: 185 DIP protein P35222 original sequence version: 151 DIP protein P35222-1 original sequence version: 151 DIP protein P35222-1 original sequence version: 171 DIP protein P35222-1 original sequence version: 148 DIP protein P35222 original sequence version: 177 DIP protein P35222 original sequence version: 178 DIP protein P35222-1 original sequence version: 178 CB78F165A3EEF86E ubr5_human E3 ubiquitin-protein ligase UBR5 UBR5 HYD KIAA0896 EDD EDD1 E3 ubiquitin-protein ligase, HECT domain-containing 1 Hyperplastic discs protein homolog Progestin-induced protein HECT-type E3 ubiquitin transferase UBR5 protein protein human Homo sapiens Human MTSIHFVVHPLPGTEDQLNDRLREVSEKLNKYNLNSHPPLNVLEQATIKQCVVGPNHAAFLLEDGRVCRIGFSVQPDRLELGKPDNNDGSKLNSNSGAGRTSRPGRTSDSPWFLSGSETLGRLAGNTLGSRWSSGVGGSGGGSSGRSSAGARDSRRQTRVIRTGRDRGSGLLGSQPQPVIPASVIPEELISQAQVVLQGKSRSVIIRELQRTNLDVNLAVNNLLSRDDEDGDDGDDTASESYLPGEDLMSLLDADIHSAHPSVIIDADAMFSEDISYFGYPSFRRSSLSRLGSSRVLLLPLERDSELLRERESVLRLRERRWLDGASFDNERGSTSKEGEPNLDKKNTPVQSPVSLGEDLQWWPDKDGTKFICIGALYSELLAVSSKGELYQWKWSESEPYRNAQNPSLHHPRATFLGLTNEKIVLLSANSIRATVATENNKVATWVDETLSSVASKLEHTAQTYSELQGERIVSLHCCALYTCAQLENSLYWWGVVPFSQRKKMLEKARAKNKKPKSSAGISSMPNITVGTQVCLRNNPLYHAGAVAFSISAGIPKVGVLMESVWNMNDSCRFQLRSPESLKNMEKASKTTEAKPESKQEPVKTEMGPPPSPASTCSDASSIASSASMPYKRRRSTPAPKEEEKVNEEQWSLREVVFVEDVKNVPVGKVLKVDGAYVAVKFPGTSSNTNCQNSSGPDADPSSLLQDCRLLRIDELQVVKTGGTPKVPDCFQRTPKKLCIPEKTEILAVNVDSKGVHAVLKTGNWVRYCIFDLATGKAEQENNFPTSSIAFLGQNERNVAIFTAGQESPIILRDGNGTIYPMAKDCMGGIRDPDWLDLPPISSLGMGVHSLINLPANSTIKKKAAVIIMAVEKQTLMQHILRCDYEACRQYLMNLEQAVVLEQNLQMLQTFISHRCDGNRNILHACVSVCFPTSNKETKEEEEAERSERNTFAERLSAVEAIANAISVVSSNGPGNRAGSSSSRSLRLREMMRRSLRAAGLGRHEAGASSSDHQDPVSPPIAPPSWVPDPPAMDPDGDIDFILAPAVGSLTTAATGTGQGPSTSTIPGPSTEPSVVESKDRKANAHFILKLLCDSVVLQPYLRELLSAKDARGMTPFMSAVSGRAYPAAITILETAQKIAKAEISSSEKEEDVFMGMVCPSGTNPDDSPLYVLCCNDTCSFTWTGAEHINQDIFECRTCGLLESLCCCTECARVCHKGHDCKLKRTSPTAYCDCWEKCKCKTLIAGQKSARLDLLYRLLTATNLVTLPNSRGEHLLLFLVQTVARQTVEHCQYRPPRIREDRNRKTASPEDSDMPDHDLEPPRFAQLALERVLQDWNALKSMIMFGSQENKDPLSASSRIGHLLPEEQVYLNQQSGTIRLDCFTHCLIVKCTADILLLDTLLGTLVKELQNKYTPGRREEAIAVTMRFLRSVARVFVILSVEMASSKKKNNFIPQPIGKCKRVFQALLPYAVEELCNVAESLIVPVRMGIARPTAPFTLASTSIDAMQGSEELFSVEPLPPRPSSDQSSSSSQSQSSYIIRNPQQRRISQSQPVRGRDEEQDDIVSADVEEVEVVEGVAGEEDHHDEQEEHGEENAEAEGQHDEHDEDGSDMELDLLAAAETESDSESNHSNQDNASGRRSVVTAATAGSEAGASSVPAFFSEDDSQSNDSSDSDSSSSQSDDIEQETFMLDEPLERTTNSSHANGAAQAPRSMQWAVRNTQHQRAASTAPSSTSTPAASSAGLIYIDPSNLRRSGTISTSAAAAAAALEASNASSYLTSASSLARAYSIVIRQISDLMGLIPKYNHLVYSQIPAAVKLTYQDAVNLQNYVEEKLIPTWNWMVSIMDSTEAQLRYGSALASAGDPGHPNHPLHASQNSARRERMTAREEASLRTLEGRRRATLLSARQGMMSARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKAMNQQTTLDTPQLERKRTRELLELGIDNEDSEHENDDDTNQSATLNDKDDDSLPAETGQNHPFFRRSDSMTFLGCIPPNPFEVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSASSGKCLMEVTVDRNCLEVLPTKMSYAANLKNVMNMQNRQKKEGEEQPVLPEETESSKPGPSAHDLAAQLKSSLLAEIGLTESEGPPLTSFRPQCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNQQSRDLSLEVDRDRDLLIQQTMRQLNNHFGRRCATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLPNLECIQNANKGTHTSLMQRLRNRGERDREREREREMRRSSGLRAGSRRDRDRDFRRQLSIDTRPFRPASEGNPSDDPEPLPAHRQALGERLYPRVQAMQPAFASKITGMLLELSPAQLLLLLASEDSLRARVDEAMELIIAHGRENGADSILDLGLVDSSEKVQQENRKRHGSSRSVVDMDLDDTDDGDDNAPLFYQPGKRGFYTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAIDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVEKMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPLYSSKQILKQKLLLAIKTKNFGFV DIP protein O95071 original sequence version: 126 871300DB404FF561 g3h996_crigr I79_006962 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEALGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL D708F170A3FBED6E g3hl00_crigr I79_011383 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MLLELSPAQLLLLLASEDSLRARVDEAMELIIAHGRENGADSILDLGLLDSSEKVQENRKRHGSSRSVVDMDLDDTDDGDDNAPLFYQPGKRGFYTPRPGRNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDAEAVFSAMDLAFAIDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLAVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVEKMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPLYSSKQILKQKLLLAIKTKNFGFV 0EF48870353350AE ubr5-gsk3b 5 16 unspecified role unspecified role bait bait n-teminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 14 unspecified role unspecified role prey prey physical association physical association Fig.1B ubr5-gsk3b-1 1 16 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association Fig. 1C ubr5-gsk3b-2 2 14 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association Fig. 1C ubr5-ctnnb1-1 1 15 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association Fig. 1D ubr5-ctnnb1-2 3 16 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey physical association physical association Fig. 1D ubr5-gsk3b-3 4 16 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 14 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1A gsk3b-ubr5-1 10 16 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 14 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 1E gsk3b-ubr5-3 6 16 unspecified role unspecified role neutral component neutral component n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 14 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig.2B ctnnb1-ubr5-1 6 15 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role neutral component neutral component n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Fig.2B ctnnb1-ubr5-2 6 16 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component decreasing_ser37_and/or_thr41 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain colocalization colocalization Fig.2A, 4C Endogenous EDD shows nuclear staining and colocalizes with the active nuclear, dephosphorylated form of beta-catenin. siEDD ctnnb1-ubr5-4 7 16 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component decreasing_ser37_and/or_thr41 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain colocalization colocalization Fig. 2A gsk3b-ubr5-5 8 14 unspecified role unspecified role bait bait region his L-histidine residue (2S)-2-amino-3-(1H-imidazol-4-yl)propanoic acid (2S)-2-amino-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 2-azanyl-3-(1H-imidazol-4-yl)propanoic acid 2-azanyl-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 4-(2-amino-2-carboxyethyl)imidazole L-histidine alpha-amino-beta-(4-imidazole)propionic acid glyoxaline-5-alanine His undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association Fig. 1E gsk3b-apc-9 9 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey physical association physical association No Figure ctnnb1-ubr5-5 6 15 unspecified role unspecified role neutral component neutral component decreasing_ser37_and/or_thr41 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain 16 unspecified role unspecified role neutral component neutral component n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Fig.3C g3h996-ubr5-1 11 16 unspecified role unspecified role neutral component neutral component n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 17 unspecified role unspecified role neutral component neutral component decreasing_phosres phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig.3C edd-g3h996-1 11 17 unspecified role unspecified role neutral component neutral component decreasing_phosres phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig.4C siEDD