IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural studies and the assembly of the heptameric post-translational translocon complex. Structural studies and the assembly of the heptameric post-translational translocon complex. J. Biol. Chem. (0021-9258) 2011 imex curation Harada Y., Li H., Wall J.S., Li H., Lennarz W.J. wlennarz@notes.cc.sunysb.edu 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast bn-page blue native page bn-page anti tag western anti tag western blot anti tag western Harada Y., Li H., Wall J.S., Li H., Lennarz W.J. The highly purified complex with progressively higher concentrations of Triton X-100, ranging from 0.1% to 1%, and then analyzed by BN-PAGE. wlennarz@notes.cc.sunysb.edu Accepted 2014-MAY-16 by MGT J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Structural studies and the assembly of the heptameric post-translational translocon complex. Structural studies and the assembly of the heptameric post-translational translocon complex. J. Biol. Chem. (0021-9258) 2011 imex curation Harada Y., Li H., Wall J.S., Li H., Lennarz W.J. wlennarz@notes.cc.sunysb.edu 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Harada Y., Li H., Wall J.S., Li H., Lennarz W.J. no no uniprot export cos I suspect someof these are indirect. wlennarz@notes.cc.sunysb.edu Accepted 2014-MAY-16 by MGT J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Structural studies and the assembly of the heptameric post-translational translocon complex. Structural studies and the assembly of the heptameric post-translational translocon complex. J. Biol. Chem. (0021-9258) 2011 imex curation Harada Y., Li H., Wall J.S., Li H., Lennarz W.J. wlennarz@notes.cc.sunysb.edu 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast comigration in sds comigration in sds page comigration in sds tag fluorescence tag visualisation by fluorescence tag fluorescence Harada Y., Li H., Wall J.S., Li H., Lennarz W.J. Microsomes weresubjected to glycerol gradient centrifugation at 100,000 × g, then incubated with anti-HA gel. The post-translocon was eluted with HA peptide and further purified by ion-exchange chromatography on Q-sepharose.. The purified post-translocon was denatured, reduced, and subsequently labeled with maleimide containing a fluorescent label. wlennarz@notes.cc.sunysb.edu Accepted 2014-MAY-16 by MGT J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Structural studies and the assembly of the heptameric post-translational translocon complex. Structural studies and the assembly of the heptameric post-translational translocon complex. J. Biol. Chem. (0021-9258) 2011 imex curation Harada Y., Li H., Wall J.S., Li H., Lennarz W.J. wlennarz@notes.cc.sunysb.edu 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip weight silver stain molecular weight estimation by silver staining weight silver stain Harada Y., Li H., Wall J.S., Li H., Lennarz W.J. Microsomes were subjected to glycerol gradient centrifugation at 100,000 × g, then incubated with anti-HA gel. The post-translocon was eluted with HA peptide and further purified by ion-exchange chromatography on Q-sepharose. wlennarz@notes.cc.sunysb.edu Accepted 2014-MAY-16 by MGT J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Structural studies and the assembly of the heptameric post-translational translocon complex. Structural studies and the assembly of the heptameric post-translational translocon complex. J. Biol. Chem. (0021-9258) 2011 imex curation Harada Y., Li H., Wall J.S., Li H., Lennarz W.J. wlennarz@notes.cc.sunysb.edu 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro scanning electron microscopy scanning electron microscopy sem sem predetermined predetermined participant predetermined Harada Y., Li H., Wall J.S., Li H., Lennarz W.J. Microsomes were subjected to glycerol gradient centrifugation at 100,000 × g, then incubated with anti-HA gel. The post-translocon was eluted with HA peptide and further purified by ion-exchange chromatography on Q-sepharose. wlennarz@notes.cc.sunysb.edu Accepted 2014-MAY-16 by MGT J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Structural studies and the assembly of the heptameric post-translational translocon complex. Structural studies and the assembly of the heptameric post-translational translocon complex. J. Biol. Chem. (0021-9258) 2011 imex curation Harada Y., Li H., Wall J.S., Li H., Lennarz W.J. wlennarz@notes.cc.sunysb.edu 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Harada Y., Li H., Wall J.S., Li H., Lennarz W.J. Microsomes were subjected to glycerol gradient centrifugation at 100,000 × g, then incubated with anti-HA gel. The post-translocon was eluted with HA peptide and further purified by ion-exchange chromatography on Q-sepharose. wlennarz@notes.cc.sunysb.edu Accepted 2014-MAY-16 by MGT J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation sc6b1_yeast Protein transport protein SBH1 Sec61 complex subunit SBH1 YER087BC YER087C-B SBH1 SEB1 Sec61 complex subunit beta protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSPTPPGGQRTLQKRKQGSSQKVAASAPKKNTNSNNSILKIYSDEATGLRVDPLVVLFLAVGFIFSVVALHVISKVAGKLF 23B0313EB37744FA sec66_yeast Translocation protein SEC66 SEC71 YBR1232 YBR171W SEC66 HSS1 Sec62/63 complex 31.5 kDa subunit Protein HSS1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEFNETKFSNNGTFFETEEPIVETKSISVYTPLIYVFILVVSLVMFASSYRKKQAKKISEQPSIFDENDAHDLYFQIKEMSENEKIHEKVLKAALLNRGAESVRRSLKLKELAPQINLLYKNGSIGEDYWKRFETEVKLIELEFKDTLQEAERLQPGWVQLFVMVCKEICFNQALSRRYQSILKRKEVCIKEWELKINNDGRLVN E2A8BB4994A227D4 E2A8BB4994A227D4 sec62_yeast Translocation protein SEC62 SEC62 YPL094C LPG14C Sec62/63 complex 30 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAVGPGSNAGASVNGGSATAIATLLRNHKELKQRQGLFQAKQTDFFRYKRFVRALHSEEYANKSARQPEIYPTIPSNKIEDQLKSREIFIQLIKAQMVIPVKKLHSQECKEHGLKPSKDFPHLIVSNKAQLEADEYFVWNYNPRTYMDYLIVIGVVSIILALVCYPLWPRSMRRGSYYVSLGAFGILAGFFAVAILRLILYVLSLIVYKDVGGFWIFPNLFEDCGVLESFKPLYGFGEKDTYSYKKKLKRMKKKQAKRESNKKKAINEKAEQN 2B2BA0DAAF3ACCA1 sec63_yeast Protein translocation protein SEC63 PTL1 YOR254C SEC63 NPL1 Sec62/63 complex 73 kDa subunit Protein NPL1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPTNYEYDEASETWPSFILTGLLMVVGPMTLLQIYQIFFGANAEDGNSGKSKEFNEEVFKNLNEEYTSDEIKQFRRKFDKNSNKKSKIWSRRNIIIIVGWILVAILLQRINSNDAIKDAATKLFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITKAYESLTDELVRQNYLKYGHPDGPQSTSHGIALPRFLVDGSASPLLVVCYVALLGLILPYFVSRWWARTQSYTKKGIHNVTASNFVSNLVNYKPSEIVTTDLILHWLSFAHEFKQFFPDLQPTDFEKLLQDHINRRDSGKLNNAKFRIVAKCHSLLHGLLDIACGFRNLDIALGAINTFKCIVQAVPLTPNCQILQLPNVDKEHFITKTGDIHTLGKLFTLEDAKIGEVLGIKDQAKLNETLRVASHIPNLKIIKADFLVPGENQVTPSSTPYISLKVLVRSAKQPLIPTSLIPEENLTEPQDFESQRDPFAMMSKQPLVPYSFAPFFPTKRRGSWCCLVSSQKDGKILQTPIIIEKLSYKNLNDDKDFFDKRIKMDLTKHEKFDINDWEIGTIKIPLGQPAPETVGDFFFRVIVKSTDYFTTDLDITMNMKVRDSPAVEQVEVYSEEDDEYSTDDDETESDDESDASDYTDIDTDTEAEDDESPE 7D6757144C8A301F sec72_yeast Translocation protein SEC72 SEC67 SIM2 L8003.18 YLR292C SEC72 Sec62/63 complex 23 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MVTLEYNANSKLITASDAVVALSTETNIDQINVLTTSLIGETNPNFTPQPNEALSKMIKGLFESGMKNLQQKKLNEALKNVSLAIEMAQRKRAPWEAFAIQLPELHFMLRSKIDLCLILGKHLEALQDLDFLLGTGLIQPDVFVRKADCLLKLRQWEEARATCERGLALAPEDMKLRALLIETARNLAEYNGE D5D200DF2DCA81DB sc61g_yeast Protein transport protein SSS1 Sec61 complex subunit SSS1 Ssh1 complex subunit SSS1 D4475 YDR086C SSS1 Sec61 complex subunit gamma Ssh1 complex subunit gamma protein protein yeast Saccharomyces cerevisiae Baker's yeast MARASEKGEEKKQSNNQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTKIVKAVGIGFIAVGIIGYAIKLIHIPIRYVIV 340F2EA913850D85 sc61a_yeast Protein transport protein SEC61 Sec61 complex subunit SEC61 L3502.5 YLR378C SEC61 Sec61 complex subunit alpha protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSNRVLDLFKPFESFLPEVIAPERKVPYNQKLIWTGVSLLIFLILGQIPLYGIVSSETSDPLYWLRAMLASNRGTLLELGVSPIITSSMIFQFLQGTQLLQIRPESKQDRELFQIAQKVCAIILILGQALVVVMTGNYGAPSDLGLPICLLLIFQLMFASLIVMLLDELLSKGYGLGSGISLFTATNIAEQIFWRAFAPTTVNSGRGKEFEGAVIAFFHLLAVRKDKKRALVEAFYRTNLPNMFQVLMTVAIFLFVLYLQGFRYELPIRSTKVRGQIGIYPIKLFYTSNTPIMLQSALTSNIFLISQILFQKYPTNPLIRLIGVWGIRPGTQGPQMALSGLAYYIQPLMSLSEALLDPIKTIVYITFVLGSCAVFSKTWIEISGTSPRDIAKQFKDQGMVINGKRETSIYRELKKIIPTAAAFGGATIGALSVGSDLLGTLGSGASILMATTTIYGYYEAAAKEGGFTKNLVPGFSDLM AB34F12FB7B3CBD4 sec62-sec63-2 2 10 unspecified role unspecified role prey prey c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role bait bait c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 1C, 1D sec62-sec66 2 8 unspecified role unspecified role prey prey c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role bait bait c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 1C, 1D sec62-sec72 2 11 unspecified role unspecified role prey prey c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role bait bait c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 1C, 1D sec62-sec61 2 13 unspecified role unspecified role prey prey c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role bait bait c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 1C, 1D sec62-sbh1 2 7 unspecified role unspecified role prey prey c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role bait bait c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 1C, 1D sec62-sss1 2 9 unspecified role unspecified role bait bait c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 12 unspecified role unspecified role prey prey c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 1C, 1D sec61-sec62 3 11 unspecified role unspecified role neutral component neutral component alexa 680 labelled cysteine alexa label alexa label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component alexa 680 labelled cysteine alexa label alexa label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component alexa 680 labelled cysteine alexa label alexa label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role neutral component neutral component alexa 680 labelled cysteine alexa label alexa label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component alexa 680 labelled cysteine alexa label alexa label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 12 unspecified role unspecified role neutral component neutral component alexa 680 labelled cysteine alexa label alexa label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2 sbh1-sec61-1 4 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 12 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association Fig. 2, 5A sbh1-sec61-2 5 11 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 13 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 3 Complex mass 287 kDa, standard deviation = 42 kDa sbh1-sec61-4 1 11 unspecified role unspecified role neutral component neutral component c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 13 unspecified role unspecified role neutral component neutral component c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role neutral component neutral component c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 12 unspecified role unspecified role neutral component neutral component c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role neutral component neutral component c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role neutral component neutral component c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 4B, 4C sbh1-sec61-5 1 11 unspecified role unspecified role neutral component neutral component c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role neutral component neutral component c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role neutral component neutral component c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role neutral component neutral component c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 4B, 4C sbh1-sec61-6 1 12 unspecified role unspecified role neutral component neutral component c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role neutral component neutral component c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role neutral component neutral component c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 4B, 4C sec62-sec63-3 1 11 unspecified role unspecified role neutral component neutral component c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role neutral component neutral component c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role neutral component neutral component c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 4B, 4C sec62-sbh1-1 4 9 unspecified role unspecified role bait bait c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 12 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey c-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey association association Fig. 5A sbh1-sec61-8 6 12 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 6B Complex mass 287 kDa, standard deviation = 42 kDa sbh1-sec61-9 6 9 unspecified role unspecified role neutral component neutral component c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role neutral component neutral component c-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 6B (lower panel), 7A Complex mass 287 kDa, standard deviation = 42 kDa