IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. FASEB J. (0892-6638) 2010 imex curation Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. It is unclear is Syn has any tags for some experiments: if they are not mentioned in a figure legend this may well mean there are NO tags anyway, or it could mean they have forgotten to say which tags are present...so I have added a "Caution" - I may be being a little too picky here? Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro electrophoresis electrophoretic mobility-based method electrophoresis weight by comassie molecular weight estimation by coomasie staining weight by comassie Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease It is unclear is Syn has any tags for some experiments: if they are not mentioned in a figure legend this may well mean there are NO tags anyway, or it could mean they have forgotten to say which tags are present...so I have added a "Caution" - I may be being a little too picky here? SDS-PAGE of protein containing eluate from column used for Molecular Sieving - from Experiment 7. Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn Accepted 2014-FEB-26 by ORCHARD FASEB J. (0892-6638) 2010 Only protein-protein interactions imex curation Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. FASEB J. (0892-6638) 2010 imex curation Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. It is unclear is Syn has any tags for some experiments: if they are not mentioned in a figure legend this may well mean there are NO tags anyway, or it could mean they have forgotten to say which tags are present...so I have added a "Caution" - I may be being a little too picky here? Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease It is unclear is Syn has any tags for some experiments: if they are not mentioned in a figure legend this may well mean there are NO tags anyway, or it could mean they have forgotten to say which tags are present...so I have added a "Caution" - I may be being a little too picky here? Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn Accepted 2014-FEB-26 by ORCHARD FASEB J. (0892-6638) 2010 Only protein-protein interactions imex curation Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. FASEB J. (0892-6638) 2010 imex curation Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. It is unclear is Syn has any tags for some experiments: if they are not mentioned in a figure legend this may well mean there are NO tags anyway, or it could mean they have forgotten to say which tags are present...so I have added a "Caution" - I may be being a little too picky here? Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink weight silver stain molecular weight estimation by silver staining weight silver stain Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease It is unclear is Syn has any tags for some experiments: if they are not mentioned in a figure legend this may well mean there are NO tags anyway, or it could mean they have forgotten to say which tags are present...so I have added a "Caution" - I may be being a little too picky here? DSS was used for cross-linking. Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn Accepted 2014-FEB-26 by ORCHARD FASEB J. (0892-6638) 2010 Only protein-protein interactions imex curation Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. FASEB J. (0892-6638) 2010 imex curation Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. It is unclear is Syn has any tags for some experiments: if they are not mentioned in a figure legend this may well mean there are NO tags anyway, or it could mean they have forgotten to say which tags are present...so I have added a "Caution" - I may be being a little too picky here? Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease It is unclear is Syn has any tags for some experiments: if they are not mentioned in a figure legend this may well mean there are NO tags anyway, or it could mean they have forgotten to say which tags are present...so I have added a "Caution" - I may be being a little too picky here? Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn Accepted 2014-FEB-26 by ORCHARD FASEB J. (0892-6638) 2010 Only protein-protein interactions imex curation Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. FASEB J. (0892-6638) 2010 imex curation Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. It is unclear is Syn has any tags for some experiments: if they are not mentioned in a figure legend this may well mean there are NO tags anyway, or it could mean they have forgotten to say which tags are present...so I have added a "Caution" - I may be being a little too picky here? Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease It is unclear is Syn has any tags for some experiments: if they are not mentioned in a figure legend this may well mean there are NO tags anyway, or it could mean they have forgotten to say which tags are present...so I have added a "Caution" - I may be being a little too picky here? Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn Accepted 2014-FEB-26 by ORCHARD FASEB J. (0892-6638) 2010 Only protein-protein interactions imex curation Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. FASEB J. (0892-6638) 2010 imex curation Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. It is unclear is Syn has any tags for some experiments: if they are not mentioned in a figure legend this may well mean there are NO tags anyway, or it could mean they have forgotten to say which tags are present...so I have added a "Caution" - I may be being a little too picky here? Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease It is unclear is Syn has any tags for some experiments: if they are not mentioned in a figure legend this may well mean there are NO tags anyway, or it could mean they have forgotten to say which tags are present...so I have added a "Caution" - I may be being a little too picky here? Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn Accepted 2014-FEB-26 by ORCHARD FASEB J. (0892-6638) 2010 Only protein-protein interactions imex curation Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. FASEB J. (0892-6638) 2010 imex curation Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. It is unclear is Syn has any tags for some experiments: if they are not mentioned in a figure legend this may well mean there are NO tags anyway, or it could mean they have forgotten to say which tags are present...so I have added a "Caution" - I may be being a little too picky here? Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease It is unclear is Syn has any tags for some experiments: if they are not mentioned in a figure legend this may well mean there are NO tags anyway, or it could mean they have forgotten to say which tags are present...so I have added a "Caution" - I may be being a little too picky here? Chemical Shift Peturbation Experiment using increasing amounts of full length a-Syn. Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn Accepted 2014-FEB-26 by ORCHARD FASEB J. (0892-6638) 2010 Only protein-protein interactions imex curation Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. FASEB J. (0892-6638) 2010 imex curation Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. It is unclear is Syn has any tags for some experiments: if they are not mentioned in a figure legend this may well mean there are NO tags anyway, or it could mean they have forgotten to say which tags are present...so I have added a "Caution" - I may be being a little too picky here? Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease It is unclear is Syn has any tags for some experiments: if they are not mentioned in a figure legend this may well mean there are NO tags anyway, or it could mean they have forgotten to say which tags are present...so I have added a "Caution" - I may be being a little too picky here? Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn Accepted 2014-FEB-26 by ORCHARD FASEB J. (0892-6638) 2010 Only protein-protein interactions imex curation Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. FASEB J. (0892-6638) 2010 imex curation Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. It is unclear is Syn has any tags for some experiments: if they are not mentioned in a figure legend this may well mean there are NO tags anyway, or it could mean they have forgotten to say which tags are present...so I have added a "Caution" - I may be being a little too picky here? Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro fcs fluorescence correlation spectroscopy FCS FCS fcs predetermined predetermined participant predetermined Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease It is unclear if Syn has any tags other than N-terminal Dansyl chloride. There could be an additional GST, T7 or myc/His tags. It is unclear is Syn has any tags for some experiments: if they are not mentioned in a figure legend this may well mean there are NO tags anyway, or it could mean they have forgotten to say which tags are present...so I have added a "Caution" - I may be being a little too picky here? Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn Accepted 2014-FEB-26 by ORCHARD FASEB J. (0892-6638) 2010 Only protein-protein interactions imex curation sncap_human Synphilin-1 Alpha-synuclein-interacting protein SNCAIP protein protein human Homo sapiens Human MEAPEYLDLDEIDFSDDISYSVTSLKTIPELCRRCDTQNEDRSVSSSSWNCGISTLITNTQKPTGIADVYSKFRPVKRVSPLKHQPETLENNESDDQKNQKVVEYQKGGESDLGPQPQELGPGDGVGGPPGKSSEPSTSLGELEHYDLDMDEILDVPYIKSSQQLASFTKVTSEKRILGLCTTINGLSGKACSTGSSESSSSNMAPFCVLSPVKSPHLRKASAVIHDQHKLSTEETEISPPLVKCGSAYEPENQSKDFLNKTFSDPHGRKVEKTTPDCQLRAFHLQSSAAESKPEEQVSGLNRTSSQGPEERSEYLKKVKSILNIVKEGQISLLPHLAADNLDKIHDENGNNLLHIAASQGHAECLQHLTSLMGEDCLNERNTEKLTPAGLAIKNGQLECVRWMVSETEAIAELSCSKDFPSLIHYAGCYGQEKILLWLLQFMQEQGISLDEVDQDGNSAVHVASQHGYLGCIQTLVEYGANVTMQNHAGEKPSQSAERQGHTLCSRYLVVVETCMSLASQVVKLTKQLKEQTVERVTLQNQLQQFLEAQKSEGKSLPSSPSSPSSPASRKSQWKSPDADDDSVAKSKPGVQEGIQVLGSLSASSRARPKAKDEDSDKILRQLLGKEISENVCTQEKLSLEFQDAQASSRNSKKIPLEKRELKLARLRQLMQRSLSESDTDSNNSEDPKTTPVRKADRPRPQPIVESVESMDSAESLHLMIKKHTLASGGRRFPFSIKASKSLDGHSPSPTSESSEPDLESQYPGSGSIPPNQPSGDPQQPSPDSTAAQKVATSPKSALKSPSSKRRTSQNLKLRVTFEEPVVQMEQPSLELNGEKDKDKGRTLQRTSTSNESGDQLKRPFGAFRSIMETLSGNQNNNNNYQAANQLKTSTLPLTSLGRKTDAKGNPASSASKGKNKAA 55C5316F250D0480 syua_human Alpha-synuclein Non-A beta component of AD amyloid Non-A4 component of amyloid precursor SNCA NACP PARK1 protein protein human Homo sapiens Human MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA DIP protein P37840 original sequence version: 124 DIP protein P37840 original sequence version: 175 DIP protein P37840 original sequence version: 178 6BB2F12128931663 snca-sncaip-10 3 10 unspecified role unspecified role neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) middle_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 1C The synphilin dimer was also detected. However a-Syn can be cross-linked with monomeric GB1-Sph1M, indicating that the dimerization of Sph1M is likely to be irrelevant to its interaction with a-Syn. snca-sncaip-4 4 10 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) middle_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role bait bait n_terminal_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 2A, 2E. sncaip-snca 5 10 unspecified role unspecified role neutral component neutral component cc_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role neutral component neutral component n_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 29 33 direct interaction direct interaction 2B, Supp Fig 1. snca-sncaip-5 8 11 unspecified role unspecified role bait bait n_terminal_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range middle_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) ecoli Escherichia coli (strain K12) direct interaction direct interaction 1B, 2D. sncaip-snca-1 9 10 unspecified role unspecified role neutral component neutral component Q9Y6H5:p.Ala519Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain A N Wed May 02 15:34:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala519asn' Tue Jun 30 16:17:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala519Asn' n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range cc1_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9Y6H5:p.Val523Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V N Wed May 02 17:45:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val523asn' Tue Jun 30 18:09:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val523Asn' Q9Y6H5:p.Lys524Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K A Wed May 02 18:52:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys524ala' Tue Jun 30 17:00:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys524Ala' Q9Y6H5:p.Lys527Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K A Wed May 02 18:07:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys527ala' Tue Jun 30 19:43:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys527Ala' ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role neutral component neutral component n_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus dansyl label dansyl label 5-dimethylaminonaphthalene-1-sulfonyl tag dansyl tag 5-dimethylaminonaphthalene-1-sulfonyl tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P37840:p.Asp2Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A Wed May 02 14:59:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp2ala' Tue Jun 30 19:03:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp2Ala' P37840:p.Val3_Phe4delinsAlaAla mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain VF AA Thu Jul 07 12:07:07 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was val3ala,phe4ala Fri Jul 22 11:02:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'val3ala,phe4ala' Wed May 02 15:49:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val_phe3-4ala_ala' Tue Jun 30 16:47:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val3_Phe4delinsAlaAla' n_terminal_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 48 53 direct interaction direct interaction 3A/B/C/D Kd values for mutants (uM):-  A519N = 1.0  V523N =1.1  K524A = 1.1  K527A =1.1 a-Syn65 D2A = 1.8 snca-snca-7 9 10 unspecified role unspecified role neutral component neutral component cc1_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role neutral component neutral component n_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus dansyl label dansyl label 5-dimethylaminonaphthalene-1-sulfonyl tag dansyl tag 5-dimethylaminonaphthalene-1-sulfonyl tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 competitor competitor competitor unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 3B snca-sncaip-6 6 10 unspecified role unspecified role neutral component neutral component coiled_coil_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role neutral component neutral component n_terminal_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization 4/5 Sph1MDelta CC (residues 349–515) mainly forms nuclear bodies with no s-syn present. sncaip-snca-2 7 11 unspecified role unspecified role neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range possible_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) cc_construct sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 7A snca-sncaip-7 2 10 unspecified role unspecified role neutral component neutral component Q9Y6H5:p.Leu529Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 19:35:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu529ala' Tue Jun 30 18:14:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu529Ala' Q9Y6H5:p.Leu525Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 17:06:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu525ala' Tue Jun 30 19:37:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu525Ala' n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) Q9Y6H5:p.Leu518Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:19:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu518ala' Tue Jun 30 18:29:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu518Ala' c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range cc_construct sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 7B snca-snca-8 5 10 unspecified role unspecified role neutral component neutral component middle_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role neutral component neutral component n_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 98 94 direct interaction direct interaction supp 6 When a-Syn12 binds to GB1-Sph1M, its NOESY spectrum exhibits a number of transferred NOE peaks, wheras few NOEs are seen for a-Syn alone. snca-sncaip-8 1 10 unspecified role unspecified role neutral component neutral component cc_construct sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9Y6H5:p.Leu529Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:36:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu529ala' Tue Jun 30 16:37:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu529Ala' n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) Q9Y6H5:p.Leu525Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 20:17:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu525ala' Tue Jun 30 17:08:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu525Ala' Q9Y6H5:p.Leu518Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:33:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu518ala' Tue Jun 30 16:08:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu518Ala' c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp 7 snca-sncaip-9 8 11 unspecified role unspecified role bait bait n_terminal_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range middle_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 1B, 2D. i snca-sncaip-11 3 10 unspecified role unspecified role neutral component neutral component n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range middle_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 1Ci The synphilin dimer was also detected. However a-Syn can be cross-linked with monomeric GB1-Sph1M, indicating that the dimerization of Sph1M is likely to be irrelevant to its interaction with a-Syn. snca-sncaip-12 4 10 unspecified role unspecified role neutral component neutral component middle_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) ecoli Escherichia coli (strain K12) direct interaction direct interaction 2A snca-sncaip-13 4 10 unspecified role unspecified role prey prey middle_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n_terminal_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 2A, 2E. snca-sncaip-14 5 10 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cys515_mtssl_paramagnetic-spin-label tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cc_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp 5 It is not clear if the His-tags have been removed from the 15N labeled SphCC proteins, or not. MTSSL (MTSL) - (1-Oxyl-2,2,5,5-tetramethylpyrroline-3- methyl)methanethiosulfonate. Paramagnetic spin labels affect nuclei near to the label, which show peak broadening and loss of signal intensity. Results here suggest an antiparallel dimer forms.