DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Interaction between chromatin proteins MECP2 and ATRX is disrupted by mutations that cause inherited mental retardation. Interaction between chromatin proteins MECP2 and ATRX is disrupted by mutations that cause inherited mental retardation. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2007 imex curation Nan X., Hou J., Maclean A., Nasir J., Lafuente M.J., Shu X., Kriaucionis S., Bird A. Brain Disease - Neurological Diseases & Disorders a.bird@ed.ac.uk Only protein-protein interactions mouse-l cells Mus musculus embryo fibroblast, Moloney Sarcoma Virus transformed l cells Mouse embryo fibroblast, Moloney Sarcoma Virus transformed anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Nan X., Hou J., Maclean A., Nasir J., Lafuente M.J., Shu X., Kriaucionis S., Bird A. Brain Disease - Neurological Diseases & Disorders Respective mouse endogenous proteins may also associate but the interaction is not unambiguously depicted in the publication a.bird@ed.ac.uk Accepted 2015-JUN-12 by PPORRAS Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2007 imex curation Interaction between chromatin proteins MECP2 and ATRX is disrupted by mutations that cause inherited mental retardation. Interaction between chromatin proteins MECP2 and ATRX is disrupted by mutations that cause inherited mental retardation. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2007 imex curation Nan X., Hou J., Maclean A., Nasir J., Lafuente M.J., Shu X., Kriaucionis S., Bird A. Brain Disease - Neurological Diseases & Disorders a.bird@ed.ac.uk Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Nan X., Hou J., Maclean A., Nasir J., Lafuente M.J., Shu X., Kriaucionis S., Bird A. Brain Disease - Neurological Diseases & Disorders a.bird@ed.ac.uk Accepted 2015-JUN-12 by PPORRAS Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2007 imex curation Interaction between chromatin proteins MECP2 and ATRX is disrupted by mutations that cause inherited mental retardation. Interaction between chromatin proteins MECP2 and ATRX is disrupted by mutations that cause inherited mental retardation. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2007 imex curation Nan X., Hou J., Maclean A., Nasir J., Lafuente M.J., Shu X., Kriaucionis S., Bird A. Brain Disease - Neurological Diseases & Disorders a.bird@ed.ac.uk Only protein-protein interactions mouse-fibroblast Mus musculus fibroblast Fibroblast fluorescence imaging fluorescence microscopy fluorescence imaging anti tag immunost anti tag immunostaining anti tag immunost Nan X., Hou J., Maclean A., Nasir J., Lafuente M.J., Shu X., Kriaucionis S., Bird A. Brain Disease - Neurological Diseases & Disorders a.bird@ed.ac.uk Accepted 2015-JUN-12 by PPORRAS Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2007 imex curation Interaction between chromatin proteins MECP2 and ATRX is disrupted by mutations that cause inherited mental retardation. Interaction between chromatin proteins MECP2 and ATRX is disrupted by mutations that cause inherited mental retardation. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2007 imex curation Nan X., Hou J., Maclean A., Nasir J., Lafuente M.J., Shu X., Kriaucionis S., Bird A. Brain Disease - Neurological Diseases & Disorders a.bird@ed.ac.uk Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Nan X., Hou J., Maclean A., Nasir J., Lafuente M.J., Shu X., Kriaucionis S., Bird A. Brain Disease - Neurological Diseases & Disorders a.bird@ed.ac.uk Accepted 2015-JUN-12 by PPORRAS Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2007 imex curation Interaction between chromatin proteins MECP2 and ATRX is disrupted by mutations that cause inherited mental retardation. Interaction between chromatin proteins MECP2 and ATRX is disrupted by mutations that cause inherited mental retardation. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2007 imex curation Nan X., Hou J., Maclean A., Nasir J., Lafuente M.J., Shu X., Kriaucionis S., Bird A. Brain Disease - Neurological Diseases & Disorders a.bird@ed.ac.uk Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Nan X., Hou J., Maclean A., Nasir J., Lafuente M.J., Shu X., Kriaucionis S., Bird A. Brain Disease - Neurological Diseases & Disorders a.bird@ed.ac.uk Accepted 2015-JUN-12 by PPORRAS human fetal brain Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2007 imex curation Interaction between chromatin proteins MECP2 and ATRX is disrupted by mutations that cause inherited mental retardation. Interaction between chromatin proteins MECP2 and ATRX is disrupted by mutations that cause inherited mental retardation. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2007 imex curation Nan X., Hou J., Maclean A., Nasir J., Lafuente M.J., Shu X., Kriaucionis S., Bird A. Brain Disease - Neurological Diseases & Disorders a.bird@ed.ac.uk Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Nan X., Hou J., Maclean A., Nasir J., Lafuente M.J., Shu X., Kriaucionis S., Bird A. Brain Disease - Neurological Diseases & Disorders a.bird@ed.ac.uk Accepted 2015-JUN-12 by PPORRAS Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2007 imex curation Interaction between chromatin proteins MECP2 and ATRX is disrupted by mutations that cause inherited mental retardation. Interaction between chromatin proteins MECP2 and ATRX is disrupted by mutations that cause inherited mental retardation. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2007 imex curation Nan X., Hou J., Maclean A., Nasir J., Lafuente M.J., Shu X., Kriaucionis S., Bird A. Brain Disease - Neurological Diseases & Disorders a.bird@ed.ac.uk Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Nan X., Hou J., Maclean A., Nasir J., Lafuente M.J., Shu X., Kriaucionis S., Bird A. Brain Disease - Neurological Diseases & Disorders a.bird@ed.ac.uk Accepted 2015-JUN-12 by PPORRAS Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2007 imex curation q00566-1 Methyl-CpG-binding protein 2 Mecp2 e2 protein protein rat Rattus norvegicus (Rat) Rat MVAGMLGLRKEKSEDQDLQGLKEKPLKFKKVKKDKKEDKEGKHEPLQPSAHHSAEPAEAGKAETSESSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTGRPKAAASEGVQVKRVLEKSPGKLLVKMPFQASPGGKGEGGGATTSAQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVQETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHAESPKAPMPLLPPPPPPEPQSSEDPISPPEPQDLSSSICKEEKMPRAGSLESDGCPKEPAKTQPMVAAAATTTTTTTTTVAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS A67E705C68BA2D38 mecp2_mouse Methyl-CpG-binding protein 2 Mecp2 protein protein mouse Mus musculus Mouse MVAGMLGLREEKSEDQDLQGLRDKPLKFKKAKKDKKEDKEGKHEPLQPSAHHSAEPAEAGKAETSESSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTGRPKAAASEGVQVKRVLEKSPGKLVVKMPFQASPGGKGEGGGATTSAQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVHETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESTKAPMPLLPSPPPPEPESSEDPISPPEPQDLSSSICKEEKMPRGGSLESDGCPKEPAKTQPMVATTTTVAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS DIP protein Q9Z2D6 original sequence version: 154 62FD228F0118A49F mecp2_rat Methyl-CpG-binding protein 2 Mecp2 protein protein rat Rattus norvegicus (Rat) Rat MVAGMLGLRKEKSEDQDLQGLKEKPLKFKKVKKDKKEDKEGKHEPLQPSAHHSAEPAEAGKAETSESSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTGRPKAAASEGVQVKRVLEKSPGKLLVKMPFQASPGGKGEGGGATTSAQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVQETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHAESPKAPMPLLPPPPPPEPQSSEDPISPPEPQDLSSSICKEEKMPRAGSLESDGCPKEPAKTQPMVAAAATTTTTTTTTVAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS A67E705C68BA2D38 mecp2_human Methyl-CpG-binding protein 2 MECP2 protein protein human Homo sapiens Human MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGATTSTQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVQETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESPKAPVPLLPPLPPPPPEPESSEDPTSPPEPQDLSSSVCKEEKMPRGGSLESDGCPKEPAKTQPAVATAATAAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS DIP protein P51608 original sequence version: 182 DIP protein P51608-1 original sequence version: 195 EB6A33233AEDA566 atrx_human Transcriptional regulator ATRX ATRX RAD54L XH2 ATP-dependent helicase ATRX X-linked helicase II X-linked nuclear protein Znf-HX protein protein human Homo sapiens Human MTAEPMSESKLNTLVQKLHDFLAHSSEESEETSSPPRLAMNQNTDKISGSGSNSDMMENSKEEGTSSSEKSKSSGSSRSKRKPSIVTKYVESDDEKPLDDETVNEDASNENSENDITMQSLPKGTVIVQPEPVLNEDKDDFKGPEFRSRSKMKTENLKKRGEDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKKKIKVDSEKSNKVYEHTSRFSPKKTSSNCNGEEKKLDDSCSGSVTYSYSALIVPKEMIKKAKKLIETTANMNSSYVKFLKQATDNSEISSATKLRQLKAFKSVLADIKKAHLALEEDLNSEFRAMDAVNKEKNTKEHKVIDAKFETKARKGEKPCALEKKDISKSEAKLSRKQVDSEHMHQNVPTEEQRTNKSTGGEHKKSDRKEEPQYEPANTSEDLDMDIVSVPSSVPEDIFENLETAMEVQSSVDHQGDGSSGTEQEVESSSVKLNISSKDNRGGIKSKTTAKVTKELYVKLTPVSLSNSPIKGADCQEVPQDKDGYKSCGLNPKLEKCGLGQENSDNEHLVENEVSLLLEESDLRRSPRVKTTPLRRPTETNPVTSNSDEECNETVKEKQKLSVPVRKKDKRNSSDSAIDNPKPNKLPKSKQSETVDQNSDSDEMLAILKEVSRMSHSSSSDTDINEIHTNHKTLYDLKTQAGKDDKGKRKRKSSTSGSDFDTKKGKSAKSSIISKKKRQTQSESSNYDSELEKEIKSMSKIGAARTTKKRIPNTKDFDSSEDEKHSKKGMDNQGHKNLKTSQEGSSDDAERKQERETFSSAEGTVDKDTTIMELRDRLPKKQQASASTDGVDKLSGKEQSFTSLEVRKVAETKEKSKHLKTKTCKKVQDGLSDIAEKFLKKDQSDETSEDDKKQSKKGTEEKKKPSDFKKKVIKMEQQYESSSDGTEKLPEREEICHFPKGIKQIKNGTTDGEKKSKKIRDKTSKKKDELSDYAEKSTGKGDSCDSSEDKKSKNGAYGREKKRCKLLGKSSRKRQDCSSSDTEKYSMKEDGCNSSDKRLKRIELRERRNLSSKRNTKEIQSGSSSSDAEESSEDNKKKKQRTSSKKKAVIVKEKKRNSLRTSTKRKQADITSSSSSDIEDDDQNSIGEGSSDEQKIKPVTENLVLSSHTGFCQSSGDEALSKSVPVTVDDDDDDNDPENRIAKKMLLEEIKANLSSDEDGSSDDEPEEGKKRTGKQNEENPGDEEAKNQVNSESDSDSEESKKPRYRHRLLRHKLTVSDGESGEEKKTKPKEHKEVKGRNRRKVSSEDSEDSDFQESGVSEEVSESEDEQRPRTRSAKKAELEENQRSYKQKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEEDENDDSKSPGKGRKKIRKILKDDKLRTETQNALKEEEERRKRIAEREREREKLREVIEIEDASPTKCPITTKLVLDEDEETKEPLVQVHRNMVIKLKPHQVDGVQFMWDCCCESVKKTKKSPGSGCILAHCMGLGKTLQVVSFLHTVLLCDKLDFSTALVVCPLNTALNWMNEFEKWQEGLKDDEKLEVSELATVKRPQERSYMLQRWQEDGGVMIIGYEMYRNLAQGRNVKSRKLKEIFNKALVDPGPDFVVCDEGHILKNEASAVSKAMNSIRSRRRIILTGTPLQNNLIEYHCMVNFIKENLLGSIKEFRNRFINPIQNGQCADSTMVDVRVMKKRAHILYEMLAGCVQRKDYTALTKFLPPKHEYVLAVRMTSIQCKLYQYYLDHLTGVGNNSEGGRGKAGAKLFQDFQMLSRIWTHPWCLQLDYISKENKGYFDEDSMDEFIASDSDETSMSLSSDDYTKKKKKGKKGKKDSSSSGSGSDNDVEVIKVWNSRSRGGGEGNVDETGNNPSVSLKLEESKATSSSNPSSPAPDWYKDFVTDADAEVLEHSGKMVLLFEILRMAEEIGDKVLVFSQSLISLDLIEDFLELASREKTEDKDKPLIYKGEGKWLRNIDYYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAANRVIIFDASWNPSYDIQSIFRVYRFGQTKPVYVYRFLAQGTMEDKIYDRQVTKQSLSFRVVDQQQVERHFTMNELTELYTFEPDLLDDPNSEKKKKRDTPMLPKDTILAELLQIHKEHIVGYHEHDSLLDHKEEEELTEEERKAAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRRLQQQYNQQQQQQMTYQQATLGHLMMPKPPNLIMNPSNYQQIDMRGMYQPVAGGMQPPPLQRAPPPMRSKNPGPSQGKSM 637E341F6A4B29C6 atrx_mouse Transcriptional regulator ATRX Xnp ATP-dependent helicase ATRX HP1 alpha-interacting protein HP1-BP38 protein Heterochromatin protein 2 X-linked nuclear protein Atrx Hp1bp2 protein protein mouse Mus musculus Mouse MTAEPMSGNKLSTLVQKLHDFLAHSSEESEETCSSPRLVMNQSTDKICGSGLNSDMMENNKEEGASTSEKSRSSGSSRSKRKPSIVTKYVESDDEKPTDENVNEKAATENSENDITMQSLPKGTVIVQPEPVLNEDKDDFKGPEFRSRSKMKADNLKKRGEDGLHGIVSCTACGQQVNHFQKDSIYRHPSLKVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICQPEPLLDLVTACNSVFENLEQLLQQNKKKIKVDSEKTSKVCDQTSKFSPKKSSSSCNGEEKKLEESCSGSVSSTYSHSALSVPKEMIKKTTKLIETTSNMNSSYIKFLKQAADNSEMTSAMKLCQLKSFKSVLDDIKKAHLALEEDLNSEIQALDDVHKEKNTKDLKSTDAKSETKLGKGEKSYSTEKREFLKLDARSSVKAIDGEEQRAHKSTSGEHKGSGRKDGSQYEPTNTPEDLDMDIVSVPSSVPEDIFDSLESAMEVQSSADYQGDGNSGTEPELESSSVKLNVSSKDSRGNIKSKVTAKVRKELFVKLTPVSLSNSPIKGVDCQEVSQEKNGRKSSGVARSSEKCRPREEISDHENNVTILLEDSDLRRSPRVKTTPLRRQTESNPAMSNSDEESNGTMKEKQKMSGPIRKKDKRNSADCATDNPKPHKVPKAKQPVIGDQNSDSDEMLAVLKEASQMGHSSSSDTDINEPQMNHKGKTGKDDNGKRKRKNSTSGSDFDTKKGKSTETSIISKKKRQNYSESSNYDSELEREIKTMSRIGAARKSVPEKKEEDSSEDEKQGKKVVDNGGHERAKTTQEGSSADDTGDTEGRQGGSCSIAGGSIEKVRSGVEFREMLCKPGVSSDGAEKPSVKEENVNSPEDKRVSKTKEKTKHLRSRQSRKGKGGSSDGTDRFPKKEQSDESSEGEKKQSRQRPGTKGKKAPDLKGETLKREQEWDSSSDGTERLPEEEEIGPFSKGIKQSKTDTAGGEKKGKKWKDKSCEKKEELSDSVDKLPGKGDSCDSSEDKKTRNRVSLREKKRFSLPAKSPGKRPECSSSDTEKSLKGQCCDSTEKRPKRIDLRERRNSSSKRNTKEVKSASSSSDAEGSSEDNKKQKKQRTSAKKKTGNTKEKKRNSLRATPKRKQVDITSSSSDIGDDDQNSAGEESSDEQKIKPVTENLVLPSHTGFCQSSGDEALSKSVPATVDDDDDDNDPENRIAKKMLLEEIKANLSSDEDGSSDDEPDGGGKKRIGKQSEESPADDGELRREQLAVNQVNSESDSDSEESKKPRYRHRLLRHKLTLSDGESGEEKPTKPKEHKEAKGRNRRKVSSEDSEDTDFQESGVSEEVSESEDEQRPRTRSAKKAELEENQRSYKQKKKRRRIKVQEDSSSENKSHSEEDKKEGDEEDEEDEDEDEEDENDDSKSPGKGRKKIRKILKDDKLRTETQNALKEEEERRKRIAEREREREKLREVIEIEDASPTKCPITTKLVLDENEETKEPLVQVHRNMVIKLKPHQVDGVQFMWDCCCESVEKTKKSPGSGCILAHCMGLGKTLQVVSFLHTVLLCDKLDFSTALVVCPLNTALNWMNEFEKWQEGLNDNEKLEVSELATVKRPQERSYMLQRWQEDGGVMIIGYEMYRNLAQGRNVKSRKLKDIFNKALVDPGPDFVVCDEGHILKNEASAVSKAMNSIKSRRRIILTGTPLQNNLIEYHCMVNFIKENLLGSIKEFRNRFINPIQNGQCADSTMVDVRVMKKRAHILYEMLAGCVQRKDYTALTKFLPPKHEYVLAVRMTAIQCKLYQYYLDHLTGVGNSTEGGRGKAGAKLFQDFQMLSRIWTHPWCLQLDYISKENKGYFDEDSMDEFIASDSDETSKSLSSDEKKKPKGKKGKKDSSSSGSGSDNDVEVIKVWNSRSRGGGDGNVDDTGNNPSVSLKLDESKTTSTSNPSSPAPDWYKDFVTDTDAEVLEHSGKMVLLFEILRMAEEIGDKVLVFSQSLISLDLIEDFLELASREKTEDKEKPLIYKGEGKWIRNIDYYRLDGSTNAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAANRVIIFDASWNPSYDIQSIFRVYRFGQTKPVYVYRFLAQGTMEDKIYDRQVTKQSLSFRVVDQQQVERHFTMNELTELYTFEPDLLDDPNSEKKKKRDTPMLPKDTILAELLQIHKEHIVGYHEHDSLLDHKEEEELTEEERKAAWAEYEAEKKGLTMRFNIPTGTNLPPVTFTSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSMTAVRIQPLEDIISTVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLINCVQRILMNRRLQQQYTQQQQQQLTYQQATLSHLMMPKPPNLIMTPSNYQQIDMRGMYQSVAGGMQPPPLQRAPPPTVRSKNPGPSPGKSM DIP protein Q61687 original sequence version: 129 DIP protein Q61687 original sequence version: 140 B2E2218B6CC791EC mecp2-atrx-1 5 12 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association no figure mecp2-atrx-2 4 12 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1a mecp2-atrx-3 6 12 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 1b and c mecp2-atrx-5 7 13 unspecified role unspecified role prey prey cell lysate cell lysate mouse-brain Mus musculus brain brain Brain [cerebrum] 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 1d The interaction was insensitive to DNase I or RNase A treatment mecp2-atrx-7 1 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nuclear localization signal fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Endogenous mouse proteins may also associate but this has not been depicted clearly in publication. 1e atrx-mecp2-1 1 12 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain nuclear localization signal fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Endogenous mouse proteins may also associate but this has not been depicted clearly in publication. 1e atrx-mecp2-3 2 9 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component colocalization colocalization 3a and SI 9 atrx-mecp2-4 6 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P51608:p.Arg133Cys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R C Wed May 02 16:01:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg133cys' Tue Jun 30 18:24:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg133Cys' Mon Mar 01 10:47:58 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q00566:p.Arg133Cys' corresponds in human MeCP UniProt AC P51608 to FTId: VAR_010273 involved in in RTT disease P51608:p.Ala140Val mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain A V Wed May 02 16:16:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala140val' Tue Jun 30 18:22:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala140Val' Mon Mar 01 11:08:29 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q00566:p.Ala140Val' corresponds in human MeCP UniProt AC P51608 to FTId: VAR_010279 involved in in MRXS13 disease P51608:p.Arg168_Arg468del mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain REQKPPKKPKSPKAPGTGRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGATTSTQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVQETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESPKAPVPLLPPLPPPPPEPESSEDPTSPPEPQDLSSSVCKEEKMPRGGSLESDGCPKEPAKTQPAVATAATAAEKYKHRGEGERKDIVSSSMPR . Wed May 02 16:01:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg133cys' Tue Jun 30 18:24:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg133Cys' corresponds in human MeCP UniProt AC P51608 to FTId: VAR_010273 involved in in RTT disease P51608:p.Arg111Gly mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R G Wed May 02 16:01:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg133cys' Tue Jun 30 18:24:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg133Cys' corresponds in human MeCP UniProt AC P51608 to FTId: VAR_010273 involved in in RTT disease Mon Mar 01 11:01:24 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q00566:p.Arg111Gly' P51608:p.Arg106Trp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R W Wed May 02 16:01:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg133cys' Tue Jun 30 18:24:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg133Cys' corresponds in human MeCP UniProt AC P51608 to FTId: VAR_010273 involved in in RTT disease Mon Mar 01 11:37:57 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q00566:p.Arg106Trp' 12 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 5a MeCP2 mutants arg106trp and arg11gly do not change the interaction; a arg168x truncation mutant also impairs the interaction. atrx-mecp2-5 3 12 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nuclear localization signal fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q00566:p.Ala140Val mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain A V Wed May 02 18:18:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala140val' Tue Jun 30 18:12:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala140Val' corresponds in human MeCP UniProt AC P51608 to FTId: VAR_010279 involved in in MRXS13 disease Q00566:p.Arg133Cys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R C Wed May 02 19:30:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg133cys' Tue Jun 30 19:00:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg133Cys' corresponds in human MeCP UniProt AC P51608 to FTId: VAR_010273 involved in in RTT disease physical association physical association 5b MeCP2 mutants arg106trp and arg11gly do not change the interaction; a arg168x truncation mutant also impairs the interaction.