IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A high resolution protein interaction map of the yeast Mediator complex. A high resolution protein interaction map of the yeast Mediator complex. Nucleic Acids Res. (0305-1048) 2004 imex curation Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M., Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M., Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M., Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M. mwerner@cea.fr 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M., Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M., Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M., Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M. Y187 strains transformed with GBD fusion proteins were crossed individually to a Y190 strain containing each of the 24 GAD fusion proteins and the 456 resulting diploids were tested for β-galactosidase activity, revealing reporter gene activation. The interactions that were found using the conjugation procedure were confirmed by co-transformation of the two Mediator subunits expressing vectors in Y190 and testing for the expression of β-galactosidase. The 19 interactions that were confirmed were considered as positives. mwerner@cea.fr Accepted 2015-JUL-20 by PPORRAS Nucleic Acids Res. (0305-1048) 2004 Only protein-protein interactions imex curation I think physical is OK in this case, as the complex has been pre-purified by anti-tag coip.; Domains from Fig 5 remain on this expt - from Supp Table1 moved to expt 4 A high resolution protein interaction map of the yeast Mediator complex. A high resolution protein interaction map of the yeast Mediator complex. Nucleic Acids Res. (0305-1048) 2004 imex curation Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M., Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M., Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M., Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M. mwerner@cea.fr 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M., Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M., Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M., Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M. mwerner@cea.fr Accepted 2015-JUL-20 by PPORRAS Nucleic Acids Res. (0305-1048) 2004 Only protein-protein interactions imex curation I think physical is OK in this case, as the complex has been pre-purified by anti-tag coip.; Domains from Fig 5 remain on this expt - from Supp Table1 moved to expt 4 A high resolution protein interaction map of the yeast Mediator complex. A high resolution protein interaction map of the yeast Mediator complex. Nucleic Acids Res. (0305-1048) 2004 imex curation Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M., Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M., Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M., Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M. mwerner@cea.fr 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column anti tag western anti tag western blot anti tag western Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M., Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M., Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M., Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M. The complex was pre-purified by anti-tag coimmunoprecipitation. mwerner@cea.fr Accepted 2015-JUL-20 by PPORRAS Nucleic Acids Res. (0305-1048) 2004 Only protein-protein interactions imex curation I think physical is OK in this case, as the complex has been pre-purified by anti-tag coip.; Domains from Fig 5 remain on this expt - from Supp Table1 moved to expt 4 A high resolution protein interaction map of the yeast Mediator complex. A high resolution protein interaction map of the yeast Mediator complex. Nucleic Acids Res. (0305-1048) 2004 imex curation Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M., Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M., Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M., Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M. mwerner@cea.fr 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M., Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M., Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M., Guglielmi B., van Berkum N.L., Klapholz B., Bijma T., Boube M., Boschiero C., Bourbon H.M., Holstege F.C., Werner M. (FRYL2) with random S.cerevisiae genomic DNA fragments fused to the GAD-encoding sequence mwerner@cea.fr Accepted 2015-JUL-20 by PPORRAS Nucleic Acids Res. (0305-1048) 2004 Only protein-protein interactions imex curation I think physical is OK in this case, as the complex has been pre-purified by anti-tag coip.; Domains from Fig 5 remain on this expt - from Supp Table1 moved to expt 4 med21_yeast Mediator of RNA polymerase II transcription subunit 21 SRB7 YDR308C D9740.17 MED21 Mediator complex subunit 21 RNAPII complex component SRB7 Suppressor of RNA polymerase B 7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTDRLTQLQICLDQMTEQFCATLNYIDKNHGFERLTVNEPQMSDKHATVVPPEEFSNTIDELSTDIILKTRQINKLIDSLPGVDVSAEEQLRKIDMLQKKLVEVEDEKIEAIKKKEKLLRHVDSLIEDFVDGIANSKKST C5B3474AF8DD662A C5B3474AF8DD662A med18_yeast Mediator of RNA polymerase II transcription subunit 18 YGR104C SRB5 MED18 Mediator complex subunit 18 Suppressor of RNA polymerase B 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVQQLSLFGSIGDDGYDLLISTLTTISGNPPLLYNSLCTVWKPNPSYDVENVNSRNQLVEPNRIKLSKEVPFSYLIDETMMDKPLNFRILKSFTNDKIPLNYAMTRNILHNTVPQVTNFNSTNEDQNNSKHTEDTVNESRNSDDIIDVDMDASPAPSNESCSPWSLQISDIPAAGNNRSVSMQTIAETIILSSAGKNSSVSSLMNGLGYVFEFQYLTIGVKFFMKHGLILELQKIWQIEEAGNSQITSGGFLLKAYINVSRGTDIDRINYTETALMNLKKELQGYIELSVPDRQSMDSRVAHGNILI B1148FC187C2802A B1148FC187C2802A med6_yeast Mediator of RNA polymerase II transcription subunit 6 MTR32 YHR058C Mediator complex subunit 6 MED6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNVTPLDELQWKSPEWIQVFGLRTENVLDYFAESPFFDKTSNNQVIKMQRQFSQLNDPNAAVNMTQNIMTLPDGKNGNLEEEFAYVDPARRQILFKYPMYMQLEEELMKLDGTEYVLSSVREPDFWVIRKQRRTNNSGVGSAKGPEIIPLQDYYIIGANIYQSPTIFKIVQSRLMSTSYHLNSTLESLYDLIEFQPSQGVHYKVPTDTSTTATAATNGNNAGGGSNKSSVRPTGGANMATVPSTTNVNMTVNTMGTGGQTIDNGTGRTGNGNMGITTEMLDKLMVTSIRSTPNYI B84E87DCC2737849 B84E87DCC2737849 med31_yeast Mediator of RNA polymerase II transcription subunit 31 SOH1 YGL127C G2864 MED31 Mediator complex subunit 31 Hpr1 suppressor protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSTNGNAPATPSSDQNPLPTRFEVELEFIQSLANIQYVTYLLTQQQIWKSPNFKNYLKYLEYWCNPPYSQCIVYPNCLFILKLLNGFMESAIVNEDGLLEGLDELPKIIQLQGPQWMNEMVERWAN A2FE3B62ADC14011 med16_yeast Mediator of RNA polymerase II transcription subunit 16 SIN4 BEL2 GAL22 SSF5 YNL236W N1135 TSF3 MED16 RYE1 SDI3 SSN4 Mediator complex subunit 16 Global transcriptional regulator SIN4 YGP1 expression regulatory protein 1 Transcriptional silencing factor 3 SWI4 suppressor protein 5 SNF1 suppressor protein 4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MMLGEHLMSWSKTGIIAYSDSQSSNANICLTFLESINGINWRFHTPQKYVLHPQLHEVQYQESSSTLSTHSTTTSVNGSTTAGVGSTPNFGGNSNKSPPQFFYNISSIHWNNWFSLPGDMLAVCDELGNMTMLITGQRPDRATTYEKLTMVFQDNVYKIYNHVMPLKPVDKLKPMNIERKQTRKEYNTSILEFRWLTSSKSVIVSQFCAFDSSSNTYRSRAQQVPPYGVYHPPFIKYACLAIRKNGQIDFWYQFSNSKDHKKITLQLLDTSNQRFKDLQWLEFARITPMNDDQCMLITTYSKLSKNISFYKLHVNWNLNATKPNVLNDPSLKIQFILSTTLDPTDDEGHVLKLENLHVVSKSSIEKDPSPEILVLYNVCDTSKSLVKRYRLAPTQLSAEYLVILKPDLNIDRNNSTNQIFQSRRYNLRRHSDIVLDKKVTLITSEMFDAFVSFYFEDGTIESYNQNDWKLETERLISQSQLGKFKNIIASPLSAGFNYGKLPLPPSVEWMKVSPSMCGVIVKQYNKKWPQFYAAVQKNYADPEKDSINATALAFGYVKSLHKQISAEDLTIAAKTHILRISFLDRKRAKEFITTLLKSLYSFFNISPDAPKEIMDKIITSRPLQKIMLLQLELGSCFSQENIEEMARVILYLKNVLFAFNGVARNFHFAIEQISNNSNQQQNPKLFQTIFSKQDLIHSLIPVAKWFVKFITYLTQEILILINDPTNKEYTLVHGIFGAKMSRTLILSILNEIKKVTQIVAKFPETSYPILNESSTFLKLVLSESPVDFEKFETFLVDVNNKFIALCEQQPSQEREFSLLVKAEIPPEYAKVGDFLLQYANNAVISHANAAAVYFADTSGLKISNSEFFNPEIFHLLQPLEEGLIIDTDKLPIKNRTSKSFSKLLYDDVTCDKLSVSEISDGKLKRCSRCGSVTRAGNIISSDKTIVPTSIQTKRWPTMYTRLCICSGMLFEMDG 12ECF5E4CDC05A8E 12ECF5E4CDC05A8E med7_yeast Mediator of RNA polymerase II transcription subunit 7 YOL135C Mediator complex subunit 7 MED7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNDPGNEVSSLYPPPPPYVKFFTQSNLEKLPKYKEKKAASAKQTAPNNSNGGSEEEITCALDYLIPPPMPKNQQYRAFGSIWQVKDQLPDLESMGLTQLYKKSTENESTNYQYKIQELRKLLKSLLLNYLELIGVLSINPDMYERKVENIRTILVNIHHLLNEYRPHQSRESLIMLLEEQLEYKRGEIREIEQVCKQVHDKLTSIQDTLRTGSQSPPSSSQ A88301E4EF3223C9 med9_yeast Mediator of RNA polymerase II transcription subunit 9 CSE2 YNR010W N2046 MED9 Mediator complex subunit 9 Chromosome segregation protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNLQNNVLNQIHQILLPTNPTLDKPNAEATKEEFSSAENRDEKDYLTNQQPKNLSTPSTSSNGEFIPHIFYSLHQIRKDPNNLSNQLETLTGSIRHRLKLCKSLISENEDTKDLLSKSPSEWQDIIHQREQELQIKRDVLDDLYRKLQR 99D2347F5287AA3C 99D2347F5287AA3C med7_drome Mediator of RNA polymerase II transcription subunit 7 MED7 Mediator complex subunit 7 dMED7 CG31390 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSNQETQVSSLPMPPERYIANYTDENIRRNRAPRPPPPPAQHEVYSMFGIQYNNDEMIRSLESQNIKRLIPIHFDRRKELKKLNHSLLVNFLDLIDFLILNPDSPRRTEKIDDISLLFVNMHHLLNEFRPHQARETLRVMMEMQKRQRVETAARFQKHLERVREIVNTAFSALPVLDDDDDSGGAKIKTEVDPLEANAAAKNDPSYQHDRMLCKLVDAIE C7ADE3C58FA47D05 med21_drome Mediator of RNA polymerase II transcription subunit 21 Mediator complex subunit 21 dMED21 dTRAP19 dSRB7 Trap19 CG17397 MED21 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MADRLTQLQDTVNQQAEHFCNAIGVIQQTSLPSKFVNFERIGPQTPIPCPPQEDYAQLFAQLIARCAKDIDTLIESLPNEDSSIELQNSSLKRLEIENQGTARDLEEVVQKGELLLEKMQYSLECIAQAQLDMQITLKHDLQ 95E2BDF375322DAC med17_yeast Mediator of RNA polymerase II transcription subunit 17 YER022W SRB4 MED17 Mediator complex subunit 17 Suppressor of RNA polymerase B 4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTTEDPDSNHLSSETGIKLALDPNLITLALSSNPNSSLHSPTSDEPVPESAGKADTSIRLEGDELENKTKKDNDKNLKFLKNKDSLVSNPHEIYGSMPLEQLIPIILRQRGPGFKFVDLNEKELQNEIKQLGSDSSDGHNSEKKDTDGADENVQIGEDFMEVDYEDKDNPVDSRNETDHKTNENGETDDNIETVMTQEQFVKRRRDMLEHINLAMNESSLALEFVSLLLSSVKESTGMSSMSPFLRKVVKPSSLNSDKIPYVAPTKKEYIELDILNKGWKLQSLNESKDLLRASFNKLSSILQNEHDYWNKIMQSISNKDVIFKIRDRTSGQKLLAIKYGYEDSGSTYKHDRGIANIRNNIESQNLDLIPHSSSVFKGTDFVHSVKKFLRVRIFTKIESEDDYILSGESVMDRDSESEEAETKDIRKQIQLLKKIIFEKELMYQIKKECALLISYGVSIENENKVIIELPNEKFEIELLSLDDDSIVNHEQDLPKINDKRANLMLVMLRLLLVVIFKKTLRSRISSPHGLINLNVDDDILIIRPILGKVRFANYKLLLKKIIKDYVLDIVPGSSITETEVEREQPQENKNIDDENITKLNKEIRAFDKLLNIPRRELKINLPLTEHKSPNLSLMLESPNYCNALIHIKFSAGTEANAVSFDTTFSDFKEVEDFLHFIVAEYIQQKKV D25B2993A1BADFD6 D25B2993A1BADFD6 med10_drome Mediator of RNA polymerase II transcription subunit 10 MED10 Nut2 Mediator complex subunit 10 dMED10 dTRAP15 CG5057 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSAPLENLETQLEMFIENVRQIRIIVSDFQPQGQNVLNQKINSLVTGLQEIDKLRSQVQDVYVPFEVFFDYIDQDKNPQLYTKDCVEKALAKNEEVKGKIEGLKKFKTNLLLELYKTFPNEMNNYRAYRKDSM 5376078EFD69FC28 med14_yeast Mediator of RNA polymerase II transcription subunit 14 RGR1 MED14 Mediator complex subunit 14 Glucose repression regulatory protein 1 YLR071C protein protein yeast Saccharomyces cerevisiae Baker's yeast MTTTIGSPQMLANEERLSNEMHALKNRSEQNGQEQQGPVKNTQLHGPSATDPETTATQKESLEMVPKDTSAATMTSAPPPALPHVEINQVSLALVIRNLTVFTMKELAQYMKTNVHTQANEPNSAKKIRFLQLIIFLRTQFLKLYVLVKWTRTIKQNNFHVLIDLLNWFRTTNMNVNNCIWALKSSLNSMTNAKLPNVDLVTALEVLSLGRPNLPTHNFKLSGVSNSMDMVDGMAKVPIGLILQRLKDLNLTVSIKIALMNIPKPLNSYHIKNGRIYFTVPNEFEIQLSTVNRQSPLFFVDLKLLFNTEAEQTVSAVTEATSTNGDSENNEENSSSNGNNLPLNKPRLEKLINEILLKSNDPLLSLYNFLHKYVLTLQLYMVHREFLKLANGGKFSKSNLIHNYDSKKSTITVRYWLNGKMDSKGKITIGIQRTTESLILKWDNQSASRAKNMPVIYNNIVSNIEGILDEIMFNHARIIRSELLARDIFQEDEENSDVLLFQLPTTCVSMAPIQLKIDLLSGQFYFRNPTPLLSNYASKINRAEGPEELARILQQLKLDKIIHVLTTMFENTGWSCSRIIKIDKPIRTQVNTGGESVVKKEDNKYAIAGNSTTNSDVSLLLQRDLFIRLPHWPLNWYLILSIISSKTSCVVEKRIGKIVSQRGKWNLKYLDNSNVMTVKLESITYQKIMILQRTILNRIINHMLIDSLNQLEIRNKICSSEMINEQKLPQYIIQGSNTNDNISIITLELESFLEGSKALNSILESSMFLRIDYSNSQIRLYAKFKRNTMMIQCQIDKLYIHFVQEEPLAFYLEESFTNLGIIVQYLTKFRQKLMQLVVLTDVVERLHKNFESENFKIIALQPNEISFKYLSNNDEDDKDCTIKISTNDDSIKNLTVQLSPSNPQHIIQPFLDNSKMDYHFIFSYLQFTSSLFKALKVILNERGGKFHESGSQYSTMVNIGLHNLNEYQIVYYNPQAGTKITICIELKTVLHNGRDKIQFHIHFADVAHITTKSPAYPMMHQVRNQVFMLDTKRLGTPESVKPANASHAIRLGNGVACDPSEIEPILMEIHNILKVDSNSSSS 96277001829DB539 96277001829DB539 med5_yeast Mediator of RNA polymerase II transcription subunit 5 NUT1 YGL151W G1876 MED5 Mediator complex subunit 5 Negative regulator of URS2 protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEKESVYNLALKCAERQLTSMEFSNLYKEFFNEKFPSLIQEEEEDTTTTANINEVKKASDLVDTPSNNTAATADTTHLHEALDIVCSDFVKILNLEKPLILADYIVEVLLVNYNSDMIKCFLPKLNSVRNSLLLAHFFSKSCSFFAKLSDTLIIDQVRKDLGNVIVPNILSLDMNSMNKELIAIVSKLLQTTLKLSPSPILLTSAGCKNGSFTLLNQLSQTNKLLFKRVSQTFEAKLHFKDTKPFLNKDSTNEFVGSPSLTSPQYIPSPLSSTKPPGSVNSAAKYKDMKLLRYYKNIWLNNKIINWEISNPDFLSKYSAITSSIFQESFNSVQNLDQLLTDLIETSFTCFAQFVSNKQYHQANSNLTLLERKWVIFITKHLPLLILENSSRSPRVVTNALDNIDEKVVKAIRIYFTEKDDNKTNNEDLFDDYPSTSLDIRHDFIKGLIMLNLQPASVINNYLREDQMIDTSILPTRDDLFVRNLQGIQEVVHNTNSFIISSLDTLELESITESITHDSSNGLFQVLHNFESVAPTKQREIVKAFLSIFEDAIKELNYNRIAKICALLFFNFSHSLTTILSFSSPAALMKTLIKFVDLSRNGRNGSNGNDESSEYETINISLSFSWAILLIINLTQTYGISVVDVALKYPELSIKNSFIINFISNLPNVSDKYYLEESNVNDSDMLTKSHNTVQSWLCDLFVNGSITDQLIQNIETRQLANLIPFIVKQVLLSVEIGVLTDISSLIGGFEYFLQPLLLVGLIKTFYWLEQFLSCVKNDTISEDILQGIFNLLNTLFNPVTLNEDSKAFHTAVLRLNAIPLLKVLRKFRVQSQSNYGIYSSDAQGDPNLEPLIAKLVAVLNVSPVYDVDPRIINSENDYSRKQLGYGKFLILNENPINKIMTNQINSFWSLHSSTYYNLDYLFELIELVTPKSFLFDVLKTLEYKLATYGVPGSENKRGSLDSEHVFDYFFYFLVLYDVKTAEEASQLIEYMENDAKKSKGDVDIKGEDLHEKNDSAEVRQETQPKAEATQDDDFDMLFGENDTSTQAYEEEEENEDNDGNNRTNNVPMIKAEETPSKTNKISILKRHSFAVLLHERKLLNDLALENGEITKTENEKFISYHDKYLCMLKTCVF BBD54661A4DB5F09 BBD54661A4DB5F09 med1_yeast Mediator of RNA polymerase II transcription subunit 1 MED1 YPR063W YPR070W Mediator complex subunit 1 YP9499.25 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVEGDSYVETLDSMIELFKDYKPGSITLENITRLCQTLGLESFTEELSNELSRLSTASKIIVIDVDYNKKQDRIQDVKLVLASNFDNFDYFNQRDGEHEKSNILLNSLTKYPDLKAFHNNLKFLYLLDAYSHIESDSTSHNNGSSDKSLDSSNASFNNQGKLDLFKYFTELSHYIRQCFQDNCCDFKVRTNLNDKFGIYILTQGINGKEVPLAKIYLEENKSDSQYRFYEYIYSQETKSWINESAENFSNGISLVMEIVANAKESNYTDLIWFPEDFISPELIIDKVTCSSNSSSSPPIIDLFSNNNYNSRIQLMNDFTTKLINIKKFDISNDNLDLISEILKWVQWSRIVLQNVFKLVSTPSSNSNSSELEPDYQAPFSTSTKDKNSSTSNTEPIPRSNRHGSVVEASRRRRSSTNKSKRPSITEAMMLKEEGLQQFNLHEILSEPAIEEENGDSIKEHSTTMDGANDLGFTASVSNQENAGTDIVMEDHGVLQGTSQNYGTATADDADIEMKDVSSKPSKPESSVLQLIVSEDHIILDTISECNLYDDVKCWSKFIEKFQDIVS 637FEA3E78D915BC med4_drome Mediator of RNA polymerase II transcription subunit 4 MED4 CG8609 Trap36 Mediator complex subunit 4 dp34 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSFHLSTKERLLLLIDDIEMIAKELIEQAHQKISSTELVDLLDLLVAKDEEFRKMLELAEEQAKVEEAMDQLRAKVEVHDREIQKLQKSLKDAELILSTAIFQARQKLASINQANKRPVSSEELIKYAHRISSANAVSAPLTWCIGDLRRPYPTDIEMRNGLLGKSEQNINGGTVTHQNSGMPSEQQRTLSGSAGSGSGSGAGGEVPNAFQNQFNWNLGELHMTMGASGNTVALETRAQDDVEVMSTDSSSSSSSDSQ B638BF3DC2294E8B ssn2_yeast Mediator of RNA polymerase II transcription subunit 13 YDR443C SSN2 SCA1 MED13 NUT8 RYE3 SRB9 UME2 Mediator complex subunit 13 Suppressor of RNA polymerase B SSN2 Protein SCA1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSDASTYRLEDVLSSFYRVEKIKKINYHQYISKAQNDQWSIQMEFMLRKQDPKTLVALLSRDLWCFSINDDPVPTPPAIEHKPVSPDKIGTFTADYSKPNLPPHYALFLKALRRKIYINLALGSHNKLIQFGNACISLSGVPNYLVQLEPHLFVNGDLTVSLCAKNMGLVPMKEENLEESFLSKHALYLAPSGIRMHLAPASKQGYLITPPKHTELLLTTLSVSHGINLQNKKNLKWVAVVPDLGHLNGHTPTIASYLTPLLEAKKLVWPLHLIFAQPVADIENSTSGDPSEFHCLQDALDAIDDFIQLKQTAAYRTPGSSGVLSSNIAGTNPLSSDGAYTEQFQHYKNNSISSQPASYHSVQETNKISPKDFSPNFTGIDKLMLSPSDQFAPAFLNTPNNNINENELFNDRKQTTVSNDLENSPLKTELEANGRSLEKVNNSVSKTGSVDTLHNKEGTLEQREQNENLPSDKSDSMVDKELFGEDEDEDLFGDSNKSNSTNESNKSISDEITEDMFEMSDEEENNNNKSINKNNKEMHTDLGKDIPFFPSSEKPNIRTMSGTTKRLNGKRKYLDIPIDEMTLPTSPLYMDPGAPLPVETPRDRRKSVFAPLNFNPIIENNVDNKYKSGGKFSFSPLQKEEALNFDISMADLSSSEEEEDEEENGSSDEDLKSLNVRDDMKPSDNISTNTNIHEPQYINYSSIPSLQDSIIKQENFNSVNDANITSNKEGFNSIWKIPQNDIPQTESPLKTVDSSIQPIESNIKMTLEDNNVTSNPSEFTPNMVNSEISNLPKDKSGIPEFTPADPNLSFESSSSLPFLLRHMPLASIPDIFITPTPVVTISEKEQDILDLIAEQVVTDYNILGNLGIPKIAYRGVKDCQEGLITTTMLQLFSTFDRLNGNDTISKFYNMKQPYVFVKKHHELIKVKHDSQPFIKFLNFRPPNGIKNFKSLLLSSSFKEDCLSFAPTLSQTYINQELGFCELLKLTNEDPPGLMYLKAFDKNKLLLLAAQIVSYCSNNKNSIKNVPPILIILPLDNATLTELVDKANIFQVIKNEVCAKMPNIELYLKVIPMDFIRNVLVTVDQYVNVAISIYNMLPPKSVKFTHIAHTLPEKVNFRTMQQQQMQQQQQQQQQQQNNSTGSSSIIYYDSYIHLAYSRSVDKEWVFAALSDSYGQGSMTKTWYVGNSRGKFDDACNQIWNIALNLASKKFGKICLILTRLNGILPDDELMNWRRLSGRNIHLAVVCVDDNSKISFIDEDKLYPSFKPIYKDTRFGGRMDMTRLYDYEIRDIDQDIHGIVFQHPFPLAHSQHRCAIRSGALIKFKKCDGDTVWDKFAVNLLNCPHSDSTQLLETILEEFRNLAALNVWYGLSDGEDGHIPWHILAVKKMMNTLVHTRVKIANTSAATVHTATSSSIILSDK 7F6CF4BBE0FAC918 med10_yeast Mediator of RNA polymerase II transcription subunit 10 NUT2 YPR168W P9325.2 MED10 Mediator complex subunit 10 Negative regulator of URS2 protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNGNSTNNEQLQQELATTQDQVASIIESFVELGVSIYDFPGTPEATKGMITNLQRNVDRLYKLNVRSNDPQSSLSKVDIPLEVVQYIEDGRNPDIYTREFVEAIRRSNQYQRGKMHGLKQLRDSLADKIVDEFPELKEPVEDIIKRTSPIDNVSNTH 0E77A43A5222E862 0E77A43A5222E862 med22_yeast Mediator of RNA polymerase II transcription subunit 22 SRB6 YBR253W YBR1721 MED22 Mediator complex subunit 22 Suppressor of RNA polymerase B 6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNQALYEKLEQTRTILSVKLAELINMTTIADRNDDDEGSFAQENSELAVATTSVMMVNNQTMQLIKNVQDLLILTRSIKEKWLLNQIPVTEHSKVTRFDEKQIEELLDNCIETFVAEKTT 7703E4FAE101A31F 7703E4FAE101A31F med20_yeast Mediator of RNA polymerase II transcription subunit 20 YHR041C SRB2 HRS2 MED20 Mediator complex subunit 20 Suppressor of RNA polymerase B 2 Hyper-recombination suppressor protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGKSAVIFVERATPATLTELKDALSNSILSVRDPWSIDFRTYRCSIKNLPADVSKLMYSITFHHHGRQTVLIKDNSAMVTTAAAADIPPALVFNGSSTGVPESIDTILSSKLSNIWMQRQLIKGDAGETLILDGLTVRLVNLFSSTGFKGLLIELQADEAGEFETKIAGIEGHLAEIRAKEYKTSSDSLGPDTSNEICDLAYQYVRALEL C30BF309D43AFB2A C30BF309D43AFB2A med11_yeast Mediator of RNA polymerase II transcription subunit 11 YMR112C YM9718.11C Mediator complex subunit 11 MED11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQPPYIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLDKSTTQLRKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQLDLLSAILDPSKSK 457D13C6030F33CC 457D13C6030F33CC med3_yeast Mediator of RNA polymerase II transcription subunit 3 PGD1 YGL025C HRS1 MED3 Mediator complex subunit 3 Poly-glutamine domain protein 1 Hyper-recombination suppressor protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDSIIPAGVKLDDLQVILAKNENETRDKVCKQINEARDEILPLRLQFNEFIQIMANIDQEGSKQADRMAKYLHIRDKILQLNDRFQTLSSHLEALQPLFSTVPEYLKTADNRDRSFQLLEPLSTYNKNGNAVCSTATVVSTNHSAAASTPTTTATPHANPITHAHSLSNPNSTATMQHNPLAGKRGPKSGSTMGTPTVHNSTAAAPIAAPKKPRKPRQTKKAKAQAQAQAQAQAQVYAQQSTVQTPITASMAAALPNPTPSMINSVSPTNVMGTPLTNMMSPMGNAYSMGAQNQGGQVSMSQFNGSGNGSNPNTNTNSNNTPLQSQLNLNNLTPANILNMSMNNDFQQQQQQQQQQQQPQPQYNMNMGMNNMNNGGKELDSLDLNNLELGGLNMDFL 69D60CE55EA30F18 med4_yeast Mediator of RNA polymerase II transcription subunit 4 O3630 Mediator complex subunit 4 MED4 YOR174W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSVQDTKAVEFSMGHIRSSSVSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNECHDELKALPMLEQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRGMLAMASLHSKELTRIPGEEVEETEVPTVPPSQSEEQKGQMAKKEGTPKTDSFIFDGTAKEVGDEADNTKDKEKEENNDDALDLDLDLFDPDDF D42A3C62D465DDAD D42A3C62D465DDAD med8_yeast Mediator of RNA polymerase II transcription subunit 8 YBR193C YBR1403 MED8 Mediator complex subunit 8 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQSTASLVPEGNQGSLQEDVSFDFNGVPGQALDAVRMRLAQLTHSLRRIRDEMSKAELPQWYTLQSQLNVTLSQLVSVTSTLQHFQETLDSTVVYPLPKFPTTSHESLVTTLLRKKNIPEVDEWMKYVRETSGVTTALLKDEEIEKLLQQDREITNWARTTFRNEYGKHDFKNEESLSEEHASLLVRDSKPSKPFNVDDVLKFTFTGEKPIITGSTSTSSSN 86B2A064293C6B61 86B2A064293C6B61 srb4-med8-6 1 27 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 3 med11-srb4-1 1 24 unspecified role unspecified role unspecified role unspecified role 14 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig. 3 srb5-med8-8 1 27 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 3 srb7-soh1-1 4 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Supp. Table 1 med11-srb6-1 1 24 unspecified role unspecified role unspecified role unspecified role 22 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig. 3 srb4-srb6-3 1 14 unspecified role unspecified role unspecified role unspecified role 22 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig. 3 srb2-srb5-1 1 23 unspecified role unspecified role unspecified role unspecified role 6 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig. 3 nut2-soh1-1 4 21 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Supp. Table 1 srb4-med6-5 4 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role bait bait physical association physical association Supp. Fig. 1 cse2-med1-1 1 11 unspecified role unspecified role unspecified role unspecified role 18 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig. 3 med1-rgr1-1 1 16 unspecified role unspecified role unspecified role unspecified role 18 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig. 3 srb4-srb7-3 4 5 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association Supp Table 1 nut1-sin4-1 4 9 unspecified role unspecified role prey prey N/A sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role bait bait physical association physical association Supp. Table 1 med4-nut2-1 4 20 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role bait bait physical association physical association Supp. Table 1 srb7-med4-2 1 26 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 3 nut2-rgr1-1 4 16 unspecified role unspecified role prey prey N/A sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 21 unspecified role unspecified role bait bait physical association physical association Supp. Table 1 med7-nut2-4 1 10 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey physical association physical association Fig. 3, Fig. 4A srb7-pgd1-1 4 25 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait physical association physical association Supp. Table 1 soh1-nut2-4 1 8 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey physical association physical association Fig. 3, Fig 4A soh1-srb4-7 2 8 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4B srb4-soh1-2 2 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4B soh1-srb4-8 3 14 unspecified role unspecified role neutral component neutral component region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4B Complex was first isolated by anti-HA coimmunoprecipitation. med4-med7-1 1 10 unspecified role unspecified role unspecified role unspecified role 26 unspecified role unspecified role unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 3, 5 med4-nut2-2 1 26 unspecified role unspecified role unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 21 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig. 3, 5 med1-med4-4 1 18 unspecified role unspecified role unspecified role unspecified role 26 unspecified role unspecified role unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig.3, 5 med4-srb7-3 1 26 unspecified role unspecified role unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig. 5 cse2-med4-4 1 11 unspecified role unspecified role unspecified role unspecified role 26 unspecified role unspecified role unspecified role unspecified role region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figs. 3, 5 med7-nut2-3 1 10 unspecified role unspecified role unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 21 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig. 3, 5 med1-med7-2 1 10 unspecified role unspecified role unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 18 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig. 3, 5 med7-srb7-2 1 10 unspecified role unspecified role unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig. 3, 5 cse2-med7-1 1 10 unspecified role unspecified role unspecified role unspecified role region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig. 3, 5 med8-srb4-3 1 14 unspecified role unspecified role unspecified role unspecified role 27 unspecified role unspecified role unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 5 med8-srb5-1 1 6 unspecified role unspecified role unspecified role unspecified role 27 unspecified role unspecified role unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 5 med8-srb2-1 1 27 unspecified role unspecified role unspecified role unspecified role region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 23 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig. 3, 5 med10-med4-1 1 19 unspecified role unspecified role unspecified role unspecified role 15 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig 7 med21-med21-2 1 13 unspecified role unspecified role unspecified role unspecified role 12 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig 7 med10-med21-1 1 15 unspecified role unspecified role unspecified role unspecified role 13 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig 7 nut2-med7-1 1 21 unspecified role unspecified role unspecified role unspecified role 10 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig. 3 srb7-med7-1 4 21 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait physical association physical association Supp. Table 1 soh1-nut2-5 1 8 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 3 nut1-med1-5 4 17 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Supp Table 1 srb7-med4-3 4 26 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait physical association physical association Supp Table 1 med7-srb7-1 4 10 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Supp Table 1 srb5-med8-9 4 27 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait physical association physical association Supp Table 1 srb7-med7-2 4 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait physical association physical association Supp Table 1 med7-nut2-5 4 10 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Supp Table 1 med7-med4-5 4 26 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role bait bait physical association physical association Supp Table 1 nut2-med7-2 4 21 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Supp Table 1 med11-srb6-2 4 24 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Supp. Table 1 srb4-med8-7 4 27 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role bait bait physical association physical association Supp Table 1