bhf-ucl Cell-specific activation of the atrial natriuretic factor promoter by PITX2 and MEF2A. Cell-specific activation of the atrial natriuretic factor promoter by PITX2 and MEF2A. J. Biol. Chem. (0021-9258) 2004 imex curation Toro R., Saadi I., Kuburas A., Nemer M., Russo A.F. Cardiac - Interactions involving cardiac related proteins andrew-russo@uiowa.edu 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Toro R., Saadi I., Kuburas A., Nemer M., Russo A.F. Cardiac - Interactions involving cardiac related proteins andrew-russo@uiowa.edu Accepted 2014-JUL-08 by MGT J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation Cell-specific activation of the atrial natriuretic factor promoter by PITX2 and MEF2A. Cell-specific activation of the atrial natriuretic factor promoter by PITX2 and MEF2A. J. Biol. Chem. (0021-9258) 2004 imex curation Toro R., Saadi I., Kuburas A., Nemer M., Russo A.F. Cardiac - Interactions involving cardiac related proteins andrew-russo@uiowa.edu 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Toro R., Saadi I., Kuburas A., Nemer M., Russo A.F. Cardiac - Interactions involving cardiac related proteins andrew-russo@uiowa.edu Accepted 2014-JUL-08 by MGT J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation mef2a_human Myocyte-specific enhancer factor 2A MEF2A MEF2 Serum response factor-like protein 1 protein protein human Homo sapiens Human MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAASSTLTDSSMLSPPQTTLHRNVSPGAPQRPPSTGNAGGMLSTTDLTVPNGAGSSPVGNGFVNSRASPNLIGATGANSLGKVMPTKSPPPPGGGNLGMNSRKPDLRVVIPPSSKGMMPPLSEEEELELNTQRISSSQATQPLATPVVSVTTPSLPPQGLVYSAMPTAYNTDYSLTSADLSALQGFNSPGMLSLGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEPISPPRDRMTPSGFQQQQQQQQQQQPPPPPQPQPQPPQPQPRQEMGRSPVDSLSSSSSSYDGSDREDPRGDFHSPIVLGRPPNTEDRESPSVKRMRMDAWVT 362BA4FBCC792CE2 pitx2_human Pituitary homeobox 2 RIEG bicoid-related homeobox transcription factor Solurshin ALL1-responsive protein ARP1 PITX2 ARP1 RGS RIEG RIEG1 Paired-like homeodomain transcription factor 2 Homeobox protein PITX2 protein protein human Homo sapiens Human METNCRKLVSACVQLGVQPAAVECLFSKDSEIKKVEFTDSPESRKEAASSKFFPRQHPGANEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRPV 00853AFDBA4433CB q99697-3 Pituitary homeobox 2 ARP1A PITX2 ARP1 RGS RIEG RIEG1 ALL1-responsive protein ARP1 Homeobox protein PITX2 Paired-like homeodomain transcription factor 2 RIEG bicoid-related homeobox transcription factor Solurshin protein protein human Homo sapiens Human METNCRKLVSACVQLEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRPV Variant in position: 58:F->L (in ASGD4). 45D2ADA6DF03FF65 pitx2-mef2a 1 3 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait c-terminal and homeodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 1 pitx2-mef2a-1 2 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined homeodomain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mads box and mef2 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction Fig. 2B pitx2-pitx2 2 4 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig. 2B