NTNU NTNU, Norwegian University of Science and Technology www.ntnu.no/home Ets transcription factors ER81 and Elk1 regulate the transcription of the human presenilin 1 gene promoter. Ets transcription factors ER81 and Elk1 regulate the transcription of the human presenilin 1 gene promoter. Brain Res. Mol. Brain Res. (0169-328X) 2003 imex curation Pastorcic M., Das H.K. 21-Jul-2014: Contacted by IntAct-Help. in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Pastorcic M., Das H.K. Accepted 2014-JUL-10 by ORCHARD Brain Res. Mol. Brain Res. (0169-328X) 2003 imex curation Ets transcription factors ER81 and Elk1 regulate the transcription of the human presenilin 1 gene promoter. Ets transcription factors ER81 and Elk1 regulate the transcription of the human presenilin 1 gene promoter. Brain Res. Mol. Brain Res. (0169-328X) 2003 imex curation Pastorcic M., Das H.K. 21-Jul-2014: Contacted by IntAct-Help. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa autoradiography autoradiography Pastorcic M., Das H.K. Accepted 2014-JUL-10 by ORCHARD Brain Res. Mol. Brain Res. (0169-328X) 2003 imex curation Ets transcription factors ER81 and Elk1 regulate the transcription of the human presenilin 1 gene promoter. Ets transcription factors ER81 and Elk1 regulate the transcription of the human presenilin 1 gene promoter. Brain Res. Mol. Brain Res. (0169-328X) 2003 imex curation Pastorcic M., Das H.K. 21-Jul-2014: Contacted by IntAct-Help. yeast Saccharomyces cerevisiae Baker's yeast 1 hybrid one hybrid yeast one-hybrid yeast one hybrid one-hybrid 1 hybrid yeast one-hybrid one-hybrid yeast one hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Pastorcic M., Das H.K. Accepted 2014-JUL-10 by ORCHARD Brain Res. Mol. Brain Res. (0169-328X) 2003 imex curation ets2_human Protein C-ets-2 ETS2 protein protein human Homo sapiens Human MNDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQEVPTGLDSISHDSANCELPLLTPCSKAVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATNEFSLVNVNLQRFGMNGQMLCNLGKERFLELAPDFVGDILWEHLEQMIKENQEKTEDQYEENSHLTSVPHWINSNTLGFGTEQAPYGMQTQNYPKGGLLDSMCPASTPSVLSSEQEFQMFPKSRLSSVSVTYCSVSQDFPGSNLNLLTNNSGTPKDHDSPENGADSFESSDSLLQSWNSQSSLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGSGPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLQNLLGFTPEELHAILGVQPDTED DIP protein P15036 original sequence version: 158 5944EC4B5AAB553E elk1_human ETS domain-containing protein Elk-1 ELK1 protein protein human Homo sapiens Human MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGHAASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP 68F71F8ADB9D38CA etv1_human ETS translocation variant 1 ETV1 ER81 Ets-related protein 81 protein protein human Homo sapiens Human MDGFYDQQVPYMVTNSQRGRNCNEKPTNVRKRKFINRDLAHDSEELFQDLSQLQETWLAEAQVPDNDEQFVPDYQAESLAFHGLPLKIKKEPHSPCSEISSACSQEQPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQEGFLAHPSRTEGCMFEKGPRQFYDDTCVVPEKFDGDIKQEPGMYREGPTYQRRGSLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAFPDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYVY DIP protein P50549 original sequence version: 102 BE95FA3F07196F06 psen1_human_dna_probe presenilin 1 DNA probe, promoter ds dna double stranded deoxyribonucleic acid ds DNA ds dna human Homo sapiens Human CGCCAGAGCCGGAATGACGACAACGGT psen1-etv1 2 7 autoradiography autoradiography autoradiography autoradiography unspecified role unspecified role bait bait radiolabel 32p radiolabel 32p radiolabel P32 32P 32P P32 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined probe represents -22 to +6 of human PSEN1 promoter region g11t_g12t mutation mutation certain certain sequence position certain certain certain sequence position certain ETV1_human (TF) did not bind to this mutated dsDNA probe 6 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction Fig 2 in vitro transcribed-translated (Promega) P50549 increases expression at RNA level of ENSG00000080815 ETV1 (P50549) increases expression at mRNA-level of PSEN1 (ENSG00000080815) as ascertained by reporter gene assay in SK-N-SH neuroblastoma cells, reported in Figure 5 psen1-etv1-1 1 7 unspecified role unspecified role bait bait radiolabel 32p radiolabel 32p radiolabel P32 32P 32P P32 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined g11t_g12t mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain ETV1_human (TF) did not bind to this mutated dsDNA probe region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined probe represents -22 to +6 of human PSEN1 promoter region 6 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction Fig 2 in vitro transcribed-translated (Promega) ETV1 (P50549) increases expression at mRNA-level of PSEN1 (ENSG00000080815) as ascertained by reporter gene assay in SK-N-SH neuroblastoma cells, reported in Figure 5 P50549 increases expression at mRNA- evel of PSEN1 ENSG00000080815 psen1-elk1 2 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined radiolabel 32p radiolabel 32p radiolabel P32 32P 32P P32 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined g11t_g12t mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey direct interaction direct interaction Fig4 P19419 decreases expression at RNA level of ENSG00000080815 ELK1 (P19419) decreases expression at mRNA level of PSEN1 (ENSG00000080815) as ascertained by reporter gene assay reported in Figure 6 psen1-etv1-2 3 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey association association first paragraph Results psen1-ets2-2 3 7 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey association association psen1-elk1-2 1 7 unspecified role unspecified role bait bait radiolabel 32p radiolabel 32p radiolabel P32 32P 32P P32 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined g11t_g12t mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain ETV1_human (TF) did not bind to this mutated dsDNA probe region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined probe represents -22 to +6 of human PSEN1 promoter region 5 unspecified role unspecified role prey prey direct interaction direct interaction Fig 4 in vitro transcribed-translated (Promega) P19419 decreases expression at RNA level of ENSG00000080815 ELK1 (P19419) decreases expression at mRNA level of PSEN1 (ENSG00000080815) as ascertained by reporter gene assay reported in Figure 6