bhf-ucl Inhibition of the Wnt signaling pathway by Idax, a novel Dvl-binding protein. Inhibition of the Wnt signaling pathway by Idax, a novel Dvl-binding protein. Mol. Cell. Biol. (0270-7306) 2001 imex curation Hino S., Kishida S., Michiue T., Fukui A., Sakamoto I., Takada S., Asashima M., Kikuchi A. Cardiac - Interactions involving cardiac related proteins akikuchi@mcai.med.hiroshima-u.ac.jp 12-May-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-l cells Mus musculus embryo fibroblast, Moloney Sarcoma Virus transformed l cells Mouse embryo fibroblast, Moloney Sarcoma Virus transformed confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Hino S., Kishida S., Michiue T., Fukui A., Sakamoto I., Takada S., Asashima M., Kikuchi A. Cardiac - Interactions involving cardiac related proteins The L cells stably express HA-Idax (L-Idax cells). akikuchi@mcai.med.hiroshima-u.ac.jp Accepted 2014-APR-28 by ORCHARD Mol. Cell. Biol. (0270-7306) 2001 Only protein-protein interactions imex curation Inhibition of the Wnt signaling pathway by Idax, a novel Dvl-binding protein. Inhibition of the Wnt signaling pathway by Idax, a novel Dvl-binding protein. Mol. Cell. Biol. (0270-7306) 2001 imex curation Hino S., Kishida S., Michiue T., Fukui A., Sakamoto I., Takada S., Asashima M., Kikuchi A. Cardiac - Interactions involving cardiac related proteins akikuchi@mcai.med.hiroshima-u.ac.jp 12-May-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Hino S., Kishida S., Michiue T., Fukui A., Sakamoto I., Takada S., Asashima M., Kikuchi A. Cardiac - Interactions involving cardiac related proteins akikuchi@mcai.med.hiroshima-u.ac.jp Accepted 2014-APR-28 by ORCHARD Mol. Cell. Biol. (0270-7306) 2001 Only protein-protein interactions imex curation Inhibition of the Wnt signaling pathway by Idax, a novel Dvl-binding protein. Inhibition of the Wnt signaling pathway by Idax, a novel Dvl-binding protein. Mol. Cell. Biol. (0270-7306) 2001 imex curation Hino S., Kishida S., Michiue T., Fukui A., Sakamoto I., Takada S., Asashima M., Kikuchi A. Cardiac - Interactions involving cardiac related proteins akikuchi@mcai.med.hiroshima-u.ac.jp 12-May-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-l cells Mus musculus embryo fibroblast, Moloney Sarcoma Virus transformed l cells Mouse embryo fibroblast, Moloney Sarcoma Virus transformed anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hino S., Kishida S., Michiue T., Fukui A., Sakamoto I., Takada S., Asashima M., Kikuchi A. Cardiac - Interactions involving cardiac related proteins The L cells stably express HA-Idax (L-Idax cells). akikuchi@mcai.med.hiroshima-u.ac.jp Accepted 2014-APR-28 by ORCHARD Mol. Cell. Biol. (0270-7306) 2001 Only protein-protein interactions imex curation Inhibition of the Wnt signaling pathway by Idax, a novel Dvl-binding protein. Inhibition of the Wnt signaling pathway by Idax, a novel Dvl-binding protein. Mol. Cell. Biol. (0270-7306) 2001 imex curation Hino S., Kishida S., Michiue T., Fukui A., Sakamoto I., Takada S., Asashima M., Kikuchi A. Cardiac - Interactions involving cardiac related proteins akikuchi@mcai.med.hiroshima-u.ac.jp 12-May-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Hino S., Kishida S., Michiue T., Fukui A., Sakamoto I., Takada S., Asashima M., Kikuchi A. Cardiac - Interactions involving cardiac related proteins akikuchi@mcai.med.hiroshima-u.ac.jp Accepted 2014-APR-28 by ORCHARD Mol. Cell. Biol. (0270-7306) 2001 Only protein-protein interactions imex curation Inhibition of the Wnt signaling pathway by Idax, a novel Dvl-binding protein. Inhibition of the Wnt signaling pathway by Idax, a novel Dvl-binding protein. Mol. Cell. Biol. (0270-7306) 2001 imex curation Hino S., Kishida S., Michiue T., Fukui A., Sakamoto I., Takada S., Asashima M., Kikuchi A. Cardiac - Interactions involving cardiac related proteins akikuchi@mcai.med.hiroshima-u.ac.jp 12-May-2014: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hino S., Kishida S., Michiue T., Fukui A., Sakamoto I., Takada S., Asashima M., Kikuchi A. Cardiac - Interactions involving cardiac related proteins akikuchi@mcai.med.hiroshima-u.ac.jp Accepted 2014-APR-28 by ORCHARD Rat brain cDNA Mol. Cell. Biol. (0270-7306) 2001 Only protein-protein interactions imex curation dvl1_human Segment polarity protein dishevelled homolog DVL-1 DVL1 DSH homolog 1 protein protein human Homo sapiens Human MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVKEEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSFHPNVASSRDGMDNETGTESMVSHRRERARRRNREEAARTNGHPRGDRRRDVGLPPDSASTALSSELESSSFVDSDEDGSTSRLSSSTEQSTSSRLIRKHKRRRRKQRLRQADRASSFSSITDSTMSLNIVTVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTVPRADPVRPIDPAAWLSHTAALTGALPRYGTSPCSSAVTRTSSSSLTSSVPGAPQLEEAPLTVKSDMSAVVRVMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNKITFSEQCYYVFGDLCSNLATLNLNSGSSGTSDQDTLAPLPHPAAPWPLGQGYPYQYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPTTKAYTVVGGPPGGPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM DIP protein O14640 original sequence version: 114 B009BDBCC57BD562 cxxc4_rat CXXC-type zinc finger protein 4 Cxxc4 Idax Inhibition of the Dvl and axin complex protein protein protein rat Rattus norvegicus (Rat) Rat MHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAEIMNLPERVGTFSAIPALGGISLPPGVIVMTALHSPAAASAAVTDSAFQIANLADCPQNHSSSSSSSSGGAGGANPAKKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPGTSLERTPVPSAEAFRWFF 9D9F7FAD11A9B759 axin1_rat Axin-1 Axin1 Axin Axis inhibition protein 1 protein protein rat Rattus norvegicus (Rat) Rat MNVQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDSRPVNHSFCSGKGTSIKSETSTATPRRSDLDLGYEPEGSASPTPPYLRWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACSGFRKLEPCDSNEEKRLKLARAIYRKYILDSNGIVSRQTKPATKSFIKDCVMKQQIDPAMFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGMSGYLPTLNEDEEWKCDQDADEDDGRDSVPPSRLTQKLLLETAAPRAPSSRRYNEGRELRYGSWREPVNPYYVNSGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESVQVNGRVPLPHIPRTYRMPKEIRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEEEGEDGEMPSGPMASHKLPSVPAWHHFPPRYVDMGCSGLRDAHEENPESILDEHVQRVMRTPGCQSPGPGHRSPDSGHVAKTAVLGGTASGHGKHAPKLGLKLDSAGLHHHRHVHHHVHHNSARPKEQMEAEAARRVQSSFSWGPETHGHAKPRSYSESTGTNPSAGDLAFGGKASAPSKRNTKKAESGKNASAEVPSTTEDAEKNQKIMQWIIEGEKEISRHRKAGHGSSGMRKQQAHESSRPLSIERPGAVHPWVSAQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRLEEEEKRANKLPSKQRTKSQRKAGGGSAPPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAILPVFEEKIIGKVEKVD BB1EE9CCECF6D487 BB1EE9CCECF6D487 dvl1_rat Segment polarity protein dishevelled homolog DVL-1 Dvl1 DSH homolog 1 protein protein rat Rattus norvegicus (Rat) Rat MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVKEEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSFHPNVASSRDGMDNETGTESMVSHRRERARRRNRDEAARTNGHPRGDRRRELGLPPDSASTVLSSELESSSFIDSDEEDNTSRLSSSTEQSTSSRLIRKHKCRRRKQRLRQTDRASSFSSITDSTMSLNIITVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTIPRADPVRPIDPAAWLSHTAALTGALPRYGTSPCSSAITRTSSSSLTSSVPGAPQLEEAPLTVKSDMSAIVRVMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSMLKHGFLRHTVNKITFSEQCYYVFGDLCSNLASLNLNSGSSGASDQDTLAPLPHPSVPWPLGQGYPYQYPGPPPCFPPAYQDPGFSYGSGSAGSQQSEGSKSSGSTRSSHRTPGREERRATGAGGSGSESDHTVPSGSGSTGWWERPVSQLSRGSSPRSQASAVAPGLPPLHPLTKAYAVVGGPPGGPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM EEC4AA99A117D22A cxxc4-dvl1 5 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association cxxc4-dvl1-1 3 6 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain The region contains the PDZ domain of DVL-1. 7 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 2A, B cxxc4-dvl1-3 2 7 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] physical association physical association Fig 2D cxxc4-dvl1-4 4 6 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain The region is the PDZ domain. ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait c-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 2E axin-dvl1-5 4 8 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey c-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain The region contains the PDZ domain. region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain This region contains the DIX domain. ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 3A axin1-cxxc4-dvl1 4 7 competitor competitor competitor prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 competitor competitor competitor prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain This region contains the DIX domain. ecoli Escherichia coli (strain K12) physical association physical association Fig 3B The authors conclude that: 'About 5 uM Idax reduced the binding of 1 uM Axin to Dvl1 by 50%, while approximately 1 uM Axin decreased the binding of 2 uM Idax to Dvl by 50%. These results suggest that the interaction of Idax with the PDZ domain is sufficient for interfering with complex formation between Dvl1 and Axin and that the affinity of Dvl1 for Axin is higher than that of Dvl1 for Idax'. dvl1-cxxc4 3 6 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 3C transfected Myc-Axin (rat). cxxc4-dvl1-5 1 7 anti tag immunost anti tag immunostaining anti tag immunost immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component fixed cell fixed cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 tag fluorescence tag visualisation by fluorescence tag fluorescence immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component fixed cell fixed cell region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Fig 4(E-G) axin1-dvl1-3 1 8 anti tag immunost anti tag immunostaining anti tag immunost immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component fixed cell fixed cell region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 tag fluorescence tag visualisation by fluorescence tag fluorescence immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component fixed cell fixed cell region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Fig 4(I-K) and (L-N).