UniProt UniProt http://www.uniprot.org Nuclear export factor CRM1 interacts with nonstructural proteins NS2 from parvovirus minute virus of mice. Nuclear export factor CRM1 interacts with nonstructural proteins NS2 from parvovirus minute virus of mice. J. Virol. (0022-538X) 1999 imex curation Bodendorf U., Cziepluch C., Jauniaux J.C., Rommelaere J., Salomé N. n.salome@dkfz-heidelberg.de Only protein-protein interactions imex curation mouse-a9 Mus musculus A9 fibroblasts a9 A9 fibroblasts anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Bodendorf U., Cziepluch C., Jauniaux J.C., Rommelaere J., Salomé N. n.salome@dkfz-heidelberg.de Accepted 2015-MAY-15 by PPORRAS J. Virol. (0022-538X) 1999 Only protein-protein interactions imex curation imex curation Nuclear export factor CRM1 interacts with nonstructural proteins NS2 from parvovirus minute virus of mice. Nuclear export factor CRM1 interacts with nonstructural proteins NS2 from parvovirus minute virus of mice. J. Virol. (0022-538X) 1999 imex curation Bodendorf U., Cziepluch C., Jauniaux J.C., Rommelaere J., Salomé N. n.salome@dkfz-heidelberg.de Only protein-protein interactions imex curation rat-frej4 Rattus norvegicus FREJ4 cell line, ras-transformed FR3T3 derivative frej4 FREJ4 cell line, ras-transformed FR3T3 derivative anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Bodendorf U., Cziepluch C., Jauniaux J.C., Rommelaere J., Salomé N. n.salome@dkfz-heidelberg.de Accepted 2015-MAY-15 by PPORRAS J. Virol. (0022-538X) 1999 Only protein-protein interactions imex curation imex curation Nuclear export factor CRM1 interacts with nonstructural proteins NS2 from parvovirus minute virus of mice. Nuclear export factor CRM1 interacts with nonstructural proteins NS2 from parvovirus minute virus of mice. J. Virol. (0022-538X) 1999 imex curation Bodendorf U., Cziepluch C., Jauniaux J.C., Rommelaere J., Salomé N. n.salome@dkfz-heidelberg.de Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bodendorf U., Cziepluch C., Jauniaux J.C., Rommelaere J., Salomé N. n.salome@dkfz-heidelberg.de Accepted 2015-MAY-15 by PPORRAS ras-transformed rat cell line FREJ4 J. Virol. (0022-538X) 1999 Only protein-protein interactions imex curation imex curation Nuclear export factor CRM1 interacts with nonstructural proteins NS2 from parvovirus minute virus of mice. Nuclear export factor CRM1 interacts with nonstructural proteins NS2 from parvovirus minute virus of mice. J. Virol. (0022-538X) 1999 imex curation Bodendorf U., Cziepluch C., Jauniaux J.C., Rommelaere J., Salomé N. n.salome@dkfz-heidelberg.de Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bodendorf U., Cziepluch C., Jauniaux J.C., Rommelaere J., Salomé N. n.salome@dkfz-heidelberg.de Accepted 2015-MAY-15 by PPORRAS ras-transformed rat cell line FREJ4 J. Virol. (0022-538X) 1999 Only protein-protein interactions imex curation imex curation p0djz2-3 Non-structural protein NS2 NS2 protein protein mumip Murine minute virus (strain MVM prototype) MAGNAYSDEVLGATNWLKEKSNQEVFSFVFKNENVQLNGKDIGWNSYKKELQEDELKSLQRGAETTWDQSEDMEWETTVDEMTKKFGTLTIHDTEKYASQPELCTNSTCIGSRGPGFRALEHTKYSCCGHCRNPEHWGSWFQSLPRWSTEPNLVRDRGGFESVLRCGTVEERLQRAAELGLRLGASWLQVPGTREQP Minor splicing isoform. 05CBF76BEACF1BCF p0djz2-2 Non-structural protein NS2 NS2 protein protein mumip Murine minute virus (strain MVM prototype) MAGNAYSDEVLGATNWLKEKSNQEVFSFVFKNENVQLNGKDIGWNSYKKELQEDELKSLQRGAETTWDQSEDMEWETTVDEMTKKFGTLTIHDTEKYASQPELCTNSTCIGSRGPGFRALEHTKYSCCGHCRNPEHWGSWFQSLPRWSTEPNLVRDRGGFESVLRCGTVEERLQRAAELGLRPEITWF Major splicing isoform (approximately 85% of the molecules). 4A43C8D6A2EBE2AA xpo1_mouse Exportin-1 Xpo1 Crm1 Chromosome region maintenance 1 protein homolog protein protein mouse Mus musculus Mouse MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFETLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHGQLLEKRLNLREALMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDIPPRRQLYLTVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTEIIMTKKLQNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTPLNPGNPVNNQMFIQDYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEERETALRQAQEEKHKLQMSVPGILNPHEIPEEMCD DIP protein Q6P5F9 original sequence version: 66 DIP protein Q6P5F9 original sequence version: 90 DIP protein Q6P5F9 original sequence version: 70 B451A19780024562 ns2_mumip Non-structural protein NS2 NS2 protein protein mumip Murine minute virus (strain MVM prototype) MAGNAYSDEVLGATNWLKEKSNQEVFSFVFKNENVQLNGKDIGWNSYKKELQEDELKSLQRGAETTWDQSEDMEWETTVDEMTKKFGTLTIHDTEKYASQPELCTNSTCIGSRGPGFRALEHTKYSCCGHCRNPEHWGSWFQSLPRWSTEPNLVRDRGGFESVLRCGTVEERLQRAAELGLRYDGASS 563514AE8357D2AA xpo1_rat Exportin-1 Xpo1 Crm1 Chromosome region maintenance 1 protein homolog protein protein rat Rattus norvegicus (Rat) Rat MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFETLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHGQLLEKRLNLREALMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDIPPRRQLYLTVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTEIIMTKKLQNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTPLNPGSPVSNQMFIQDYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEERETALRQAQEEKHKLQMSVPGILNPHEIPEEMCD CFF018979B93F70D p0djz2-1 Non-structural protein NS2 NS2 protein protein mumip Murine minute virus (strain MVM prototype) MAGNAYSDEVLGATNWLKEKSNQEVFSFVFKNENVQLNGKDIGWNSYKKELQEDELKSLQRGAETTWDQSEDMEWETTVDEMTKKFGTLTIHDTEKYASQPELCTNSTCIGSRGPGFRALEHTKYSCCGHCRNPEHWGSWFQSLPRWSTEPNLVRDRGGFESVLRCGTVEERLQRAAELGLRYDGASS Splicing isoform (approximately 15% of the molecules). 563514AE8357D2AA ns2-ns2-3 4 6 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1A ns2-ns2-2 3 6 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1B ns2-ns2-4 3 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1B ns2-xpo1-1 3 5 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1B ns2-xpo1-3 2 8 unspecified role unspecified role bait bait infection infection 9 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4A and B 14-3-3 proteins have also been precipitated but cannot be mapped to specific proteins xpo1-ns2-2 2 8 unspecified role unspecified role prey prey infection infection region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait physical association physical association 4B 14-3-3 proteins have also been precipitated but cannot be mapped to specific proteins ns2-xpo1-4 1 7 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait physical association physical association 5A and B Infection with NS2 thr149ala mutant (impaired phosohorylation) also interacted. xpo1-ns2-1 1 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NS2 non-phosphorylated form detected physical association physical association 5A