IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Trading places on DNA--a three-point switch underlies primer handoff from primase to the replicative DNA polymerase. Trading places on DNA--a three-point switch underlies primer handoff from primase to the replicative DNA polymerase. Cell (0092-8674) 1999 imex curation Yuzhakov A., Kelman Z., O'Donnell M. odonnel@rockvax.rockefeller.edu 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Yuzhakov A., Kelman Z., O'Donnell M. oligo(dT) is 100 nt long. odonnel@rockvax.rockefeller.edu Accepted 2013-JUN-26 by MGT 02-Aug-2013: Contacted by IntAct-Help. Cell (0092-8674) 1999 Only protein-protein interactions imex curation Trading places on DNA--a three-point switch underlies primer handoff from primase to the replicative DNA polymerase. Trading places on DNA--a three-point switch underlies primer handoff from primase to the replicative DNA polymerase. Cell (0092-8674) 1999 imex curation Yuzhakov A., Kelman Z., O'Donnell M. odonnel@rockvax.rockefeller.edu 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro solid phase assay solid phase assay autoradiography autoradiography Yuzhakov A., Kelman Z., O'Donnell M. odonnel@rockvax.rockefeller.edu Accepted 2013-JUN-26 by MGT 02-Aug-2013: Contacted by IntAct-Help. Cell (0092-8674) 1999 Only protein-protein interactions imex curation dnag_ecoli DNA primase dnaG dnaP parB b3066 JW3038 protein protein ecoli Escherichia coli (strain K12) MAGRIPRVFINDLLARTDIVDLIDARVKLKKQGKNFHACCPFHNEKTPSFTVNGEKQFYHCFGCGAHGNAIDFLMNYDKLEFVETVEELAAMHNLEVPFEAGSGPSQIERHQRQTLYQLMDGLNTFYQQSLQQPVATSARQYLEKRGLSHEVIARFAIGFAPPGWDNVLKRFGGNPENRQSLIDAGMLVTNDQGRSYDRFRERVMFPIRDKRGRVIGFGGRVLGNDTPKYLNSPETDIFHKGRQLYGLYEAQQDNAEPNRLLVVEGYMDVVALAQYGINYAVASLGTSTTADHIQLLFRATNNVICCYDGDRAGRDAAWRALETALPYMTDGRQLRFMFLPDGEDPDTLVRKEGKEAFEARMEQAMPLSAFLFNSLMPQVDLSTPDGRARLSTLALPLISQVPGETLRIYLRQELGNKLGILDDSQLERLMPKAAESGVSRPVPQLKRTTMRILIGLLVQNPELATLVPPLENLDENKLPGLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIARERTHGLSNEERLELWTLNQELAKK 294CF020E7B45D94 294CF020E7B45D94 ssb_ecoli Single-stranded DNA-binding protein Helix-destabilizing protein ssb exrB lexC b4059 JW4020 protein protein ecoli Escherichia coli (strain K12) MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSAPAAPSNEPPMDFDDDIPF DIP protein P0AGE0 original sequence version: 44 F0AF43B6DC8D02FC dt-dna oligo(dT) dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) holc_ecoli DNA polymerase III subunit chi holC b4259 JW4216 protein protein ecoli Escherichia coli (strain K12) MKNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARPAESFVPHNLAGEGPRGGAPVEIAWPQKRSSSRRDILISLRTSFADFATAFTEVVDFVPYEDSLKQLARERYKAYRVAGFNLNTATWK 7FEFFC359B28AA88 7FEFFC359B28AA88 ssb-dnag 2 3 unspecified role unspecified role prey prey region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait direct interaction direct interaction Fig. 4e, f ssb-dnag-holc 2 3 unspecified role unspecified role prey prey region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait 6 competitor competitor competitor prey prey physical association physical association Fig. 4e, f ssb-dt_dna-holc 1 6 competitor competitor competitor prey prey 5 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role prey prey physical association physical association Fig. 4a Experiments were carried out at 24C and 37C. At 37C the SSB-ser113pro mutant did not bind to holc. ssb-dt_dna-dnag 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 4b Experiments were carried out at 24C and 37C.