UniProt UniProt http://www.uniprot.org A novel membrane protein is a mouse mammary tumor virus receptor. A novel membrane protein is a mouse mammary tumor virus receptor. J. Virol. (0022-538X) 1998 imex curation Golovkina T.V., Dzuris J., van den Hoogen B., Jaffe A.B., Wright P.C., Cofer S.M., Ross S.R. For western blotting a anti-MMTV antiserum has been used and the gp73/gp70 envelope precursor was determined using MW. The processed envelope gp52 protein could not be determined this way. rosss@mail.med.upenn.edu 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Golovkina T.V., Dzuris J., van den Hoogen B., Jaffe A.B., Wright P.C., Cofer S.M., Ross S.R. For western blotting a anti-MMTV antiserum has been used and the gp73/gp70 envelope precursor was determined using MW. The processed envelope gp52 protein could not be determined this way. ross@mail.med.upenn.edu rosss@mail.med.upenn.edu Accepted 2013-NOV-15 by MGT 22-Nov-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 1998 Only protein-protein interactions imex curation q9qui1-2 Leucine repeat adapter protein 25 MMTV receptor variant 1 Fam89b C184m Mtvr2 C184L ORF2 protein C184M protein MMTV receptor Lrap25 protein protein mouse Mus musculus Mouse MNGLPATEAPGGAGCALAGLPPLPRGLSGLLNASGGSWRELERVYSQRSRIHDELSRAARAPDGPRHAAGSANSGSAAGPRRPVNLDSALAALRKEMLWGLYESIQDYKHLCQDLSLCQDLSSSLHSDSSYPPDAGLSDDEEPPDASLPPDPPPLTVPQTHNARDQWLQDAFQISL 718E385DA41115F2 env_mmtvc Envelope glycoprotein gp70 env Env polyprotein protein protein mmtvc Mouse mammary tumor virus (strain C3H) MPNHQSGSPTGSSDLLLDGKKQRAHLALRRKRRREMRKINRKVRRMNLAPIKEKTAWQHLQALIFEAEEVLKTSQTPQTSLTLFLALLSVLGPPPVSGESYWAYLPKPPILHPVGWGNTDPIRVLTNQTIYLGGSPDFHGFRNMSGNVHFEEKSDTLPICFSFSFSTPTGCFQVDKQVFLSDTPTVDNNKPGGKGDKRRMWELWLTTLGNSGANTKLVPIKKKLPPKYPHCQIAFKKDAFWEGDESAPPRWLPCAFPDQGVSFSPKGALGLLWDFSLPSPSVDQSDQIKSKKDLFGNYTPPVNKEVHRWYEAGWVEPTWFWENSPKDPNDRDFTALVPHTELFRLVAASRYLILKRPGFQEHEMIPTSACVTYPYVILLGLPQLIDIEKRGSTFHISCSSCRLTNCLDSSAYDYAAIIVKRPPYVLLPVDIGDEPWFDDSAIQTFRYATDLIRAKRFVAAIILGISALIAIITSFAVATTALVKEMQTATFVNNLHRNVTLALSEQRIIDLKLEARLNALEEVVLDLGQDVANLKTRMSTRCHANYDFICVTPLPYNASESWERTKAHLLGIWNDNEISYNIQELTNLIGDMSKQHIDTVDLSGLAQSFANGVKALNPLDWTQYFIFIGVGALLLVIVLMIFPIVFQCLAKSLDQVQSDLNVLLLKKKKGGNAAPAAEMVELPRVSYT E76B3D38E2A01C0A fam89b-env 1 3 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection 2 unspecified role unspecified role bait bait n-terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 7