UniProt UniProt http://www.uniprot.org A p18 mutant defective in CDK6 binding in human breast cancer cells. A p18 mutant defective in CDK6 binding in human breast cancer cells. Cancer Res. (0008-5472) 1996 imex curation Lapointe J., Lachance Y., Labrie Y., Labrie C. claude.labrie@crchul.ulaval.ca 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Lapointe J., Lachance Y., Labrie Y., Labrie C. claude.labrie@crchul.ulaval.ca Accepted 2013-JUN-24 by MGT 02-Aug-2013: Contacted by IntAct-Help. Cancer Res. (0008-5472) 1996 Only protein-protein interactions imex curation cdn2c_human Cyclin-dependent kinase 4 inhibitor C CDKN2C CDKN6 p18-INK4c Cyclin-dependent kinase 6 inhibitor p18-INK6 protein protein human Homo sapiens Human MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ 5D66AFA715186E9A cdk6_human Cyclin-dependent kinase 6 CDK6 Serine/threonine-protein kinase PLSTIRE Cell division protein kinase 6 CDKN6 protein protein human Homo sapiens Human MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA 571733EE6BE7FD4A cdk6-cdkn2c-1 1 2 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P42773:p.Ala72Pro mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain A P Wed May 02 19:02:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala72pro' Tue Jun 30 18:57:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala72Pro' UniProt FTId: VAR_001490 in vitro In vitro 3 unspecified role unspecified role bait bait Q00534:p.Arg31Cys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R C Wed May 02 18:48:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg31cys' Tue Jun 30 15:57:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg31Cys' n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 2A