HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Complex processing and protein:protein interactions in the E2:NS2 region of HCV. Complex processing and protein:protein interactions in the E2:NS2 region of HCV. Virology (0042-6822) 1994 imex curation Selby M.J., Glazer E., Masiarz F., Houghton M. Virus - Publications including interactions involving viral proteins 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation pantr-fibroblast Pan troglodytes fibroblast Fibroblast anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Selby M.J., Glazer E., Masiarz F., Houghton M. Virus - Publications including interactions involving viral proteins Accepted 2013-SEP-19 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. Virology (0042-6822) 1994 imex curation Complex processing and protein:protein interactions in the E2:NS2 region of HCV. Complex processing and protein:protein interactions in the E2:NS2 region of HCV. Virology (0042-6822) 1994 imex curation Selby M.J., Glazer E., Masiarz F., Houghton M. Virus - Publications including interactions involving viral proteins 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-bsc40 Chlorocebus aethiops Grivet bsc40 Cerae kidney epithelial cells http://www.lgcpromochem-atcc.com/common/catalog/numSearch/numResults.cfm?atccNum=CRL-2761 these cells are temperature tolerant anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Selby M.J., Glazer E., Masiarz F., Houghton M. Virus - Publications including interactions involving viral proteins Accepted 2013-SEP-19 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. Virology (0042-6822) 1994 imex curation p27958-pro_0000037569 Envelope glycoprotein E1 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) YQVRNSSGLYHVTNDCPNSSVVYEAADAILHTPGCVPCVREGNASRCWVAVTPTVATRDGKLPTTQLRRHIDLLVGSATLCSALYVGDLCGSVFLVGQLFTFSPRHHWTTQDCNCSIYPGHITGHRMAWNMMMNWSPTAALVVAQLLRIPQAIMDMIAGAHWGVLAGIKYFSMVGNWAKVLVVLLLFAGVDA 192 383 62EDCA90D2CEBCE8 p27958-pro_0000037572 Protease NS2 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) LDTEVAASCGGVVLVGLMALTLSPYYKRYISWCMWWLQYFLTRVEAQLHVWVPPLNVRGGRDAVILLTCVVHPALVFDITKLLLAIFGPLWILQASLLKVPYFVRVQGLLRICALARKIAGGHYVQMAIIKLGALTGTCVYNHLAPLRDWAHNGLRDLAVAVEPVVFSRMETKLITWGADTAACGDIINGLPVSARRGQEILLGPADGMVSKGWRLL 810 1026 2036555B07778591 p27958-pro_0000037575 Non-structural protein 4B protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) SQHLPYIEQGMMLAEQFKQKALGLLQTASRHAEVITPAVQTNWQKLEVFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTGQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAALDSVGLGKVLVDILAGYGAGVAGALVAFKIMSGEVPSTEDLVNLLPAILSPGALAVGVVFASILRRRVGPGEGAVQWMNRLIAFASRGNHVSPTHYVPESDAAARVTAILSSLTVTQLLRRLHQWISSECTTPC 1712 1972 9BDA1D19BD9A0A17 p27958-pro_0000037570 Envelope glycoprotein E2 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) ETHVTGGNAGRTTAGLVGLLTPGAKQNIQLINTNGSWHINSTALNCNESLNTGWLAGLFYQHKFNSSGCPERLASCRRLTDFAQGWGPISYANGSGLDERPYCWHYPPRPCGIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSWGANDTDVFVLNNTRPPLGNWFGCTWMNSTGFTKVCGAPPCVIGGVGNNTLLCPTDCFRKYPEATYSRCGSGPRITPRCMVDYPYRLWHYPCTINYTIFKVRMYVGGVEHRLEAACNWTRGERCDLEDRDRSELSPLLLSTTQWQVLPCSFTTLPALSTGLIHLHQNIVDVQYLYGVGSSIASWAIKWEYVVLLFLLLADARVCSCLWMMLLISQAEA 384 746 9243E2103B6CCA2D p27958_pr-p27958_p-1 2 E2 6 unspecified role unspecified role bait bait 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain E1 3 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2 e2-ns2b-1 1 NS2 4 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined E2 6 unspecified role unspecified role bait bait 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain NS4B 5 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 6 e1-e2-ns2b-1 1 E2 6 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined E1 3 unspecified role unspecified role bait bait 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NS2 4 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 5