HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Transport and uptake of retinol during chicken oocyte growth. Transport and uptake of retinol during chicken oocyte growth. Biochim. Biophys. Acta (0006-3002) 1993 imex curation Vieira A.V., Schneider W.J. (none) 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation chick-serum Chick serum serum Serum fluorescence fluorescence technology fluorescence polyclonal western polyclonal antibody western blot polyclonal western Vieira A.V., Schneider W.J. RBP4 from RBP4-TTR complex is used here to confirm retinol binding to RBP4. So in reality RBP4 is bound to both retinol and TTR. (none) Accepted 2013-MAY-17 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Biochim. Biophys. Acta (0006-3002) 1993 imex curation Transport and uptake of retinol during chicken oocyte growth. Transport and uptake of retinol during chicken oocyte growth. Biochim. Biophys. Acta (0006-3002) 1993 imex curation Vieira A.V., Schneider W.J. (none) 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation chick-yolk Chicken egg yolk yolk Egg yolk anti bait coip anti bait coimmunoprecipitation anti bait coip polyclonal western polyclonal antibody western blot polyclonal western Vieira A.V., Schneider W.J. (none) Accepted 2013-MAY-17 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. anti-TTR immunoaffinity Biochim. Biophys. Acta (0006-3002) 1993 imex curation Transport and uptake of retinol during chicken oocyte growth. Transport and uptake of retinol during chicken oocyte growth. Biochim. Biophys. Acta (0006-3002) 1993 imex curation Vieira A.V., Schneider W.J. (none) 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation chick-yolk Chicken egg yolk yolk Egg yolk fluorescence fluorescence technology fluorescence polyclonal western polyclonal antibody western blot polyclonal western Vieira A.V., Schneider W.J. RBP4 from RBP4-TTR complex is used here to confirm retinol binding to RBP4. So in reality RBP4 is bound to both retinol and TTR. (none) Accepted 2013-MAY-17 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Biochim. Biophys. Acta (0006-3002) 1993 imex curation Transport and uptake of retinol during chicken oocyte growth. Transport and uptake of retinol during chicken oocyte growth. Biochim. Biophys. Acta (0006-3002) 1993 imex curation Vieira A.V., Schneider W.J. (none) 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation chick-serum Chick serum serum Serum molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column polyclonal western polyclonal antibody western blot polyclonal western Vieira A.V., Schneider W.J. (none) Accepted 2013-MAY-17 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Biochim. Biophys. Acta (0006-3002) 1993 imex curation Transport and uptake of retinol during chicken oocyte growth. Transport and uptake of retinol during chicken oocyte growth. Biochim. Biophys. Acta (0006-3002) 1993 imex curation Vieira A.V., Schneider W.J. (none) 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation chick-serum Chick serum serum Serum anti bait coip anti bait coimmunoprecipitation anti bait coip polyclonal western polyclonal antibody western blot polyclonal western Vieira A.V., Schneider W.J. (none) Accepted 2013-MAY-17 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. anti-TTR immunoaffinity Biochim. Biophys. Acta (0006-3002) 1993 imex curation Transport and uptake of retinol during chicken oocyte growth. Transport and uptake of retinol during chicken oocyte growth. Biochim. Biophys. Acta (0006-3002) 1993 imex curation Vieira A.V., Schneider W.J. (none) 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation chick-yolk Chicken egg yolk yolk Egg yolk molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column polyclonal western polyclonal antibody western blot polyclonal western Vieira A.V., Schneider W.J. (none) Accepted 2013-MAY-17 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Biochim. Biophys. Acta (0006-3002) 1993 imex curation tthy_chick Transthyretin TTR Prealbumin TBPA protein protein chick Gallus gallus (Chicken) Chicken MAFHSTLLVFLAGLVFLSEAAPLVSHGSVDSKCPLMVKVLDAVRGSPAANVAVKVFKKAADGTWQDFATGKTTEFGEIHELTTEEQFVEGVYRVEFDTSSYWKGLGLSPFHEYADVVFTANDSGHRHYTIAALLSPFSYSTTAVVSDPQE 1F82A776A9996360 ret4_chick Retinol-binding protein 4 RBP4 Plasma retinol-binding protein protein protein chick Gallus gallus (Chicken) Chicken MAYTWRALLLLALAFLGSSMAERDCRVSSFKVKENFDKNRYSGTWYAMAKKDPEGLFLQDNVVAQFTVDENGQMSATAKGRVRLFNNWDVCADMIGSFTDTEDPAKFKMKYWGVASFLQKGNDDHWVVDTDYDTYALHYSCRELNEDGTCADSYSFVFSRDPKGLPPEAQKIVRQRQIDLCLDRKYRVIVHNGFCS 5E9423A14578DA75 chebi:50211 retinol small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) rbp4-ttr-7 4 TTR 7 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level RBP 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 2A protein complex in chicken serum rbp4-ttr-3 5 RBP 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level RBP4 possibly bound to retinol; resolved in another annotation TTR 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 3 RBP-TTR complex in hen serum rbp4-retinol-1 1 retinol 9 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept naturally occurring naturally occurring endogenous endogenous participant id method is "inferred by author" RBP 8 unspecified role unspecified role fluorescence donor fluorescence donor physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 4 Here RBP4 is actually from TTR-RBP4 complex from hen serum. So it is a complex where RBP4 is bound to both TTR and retinol rbp4-ttr-8 6 TTR 7 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level RBP 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 2B protein complex in aqueous extract of chicken yolk rbp4-ttr-6 2 RBP 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level RBP4 possibly bound to retinol; resolved in another annotation TTR 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 3 RBP4-TTR complex in hen yolk chebi_50211-rbp4-1 3 retinol 9 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept naturally occurring naturally occurring endogenous endogenous participant id method is "inferred by author" RBP 8 unspecified role unspecified role fluorescence donor fluorescence donor physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 4 Here RBP4 is actually from TTR-RBP4 complex from hen yolk. So it is a complex where RBP4 is bound to both TTR and retinol