MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Characterization of a periplasmic nitrate reductase in complex with its biosynthetic chaperone. Characterization of a periplasmic nitrate reductase in complex with its biosynthetic chaperone. The FEBS journal 2013 imex curation Jennifer M. Dow1*, Sabine Grahl1,4*, Richard Ward2, Rachael Evans1,Olwyn Byron3, David G. Norman2, Tracy Palmer1† and Frank Sargent1†, Dow JM., Grahl S., Ward R., Evans R., Byron O., Norman DG., Palmer T., Sargent F. f.sargent@dundee.ac.uk 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Jennifer M. Dow1*, Sabine Grahl1,4*, Richard Ward2, Rachael Evans1, Olwyn Byron3, David G. Norman2, Tracy Palmer1† and Frank Sargent1† f.sargent@dundee.ac.uk Accepted 2013-OCT-31 by LUANA 2013 imex curation Characterization of a periplasmic nitrate reductase in complex with its biosynthetic chaperone. Characterization of a periplasmic nitrate reductase in complex with its biosynthetic chaperone. The FEBS journal 2013 imex curation Jennifer M. Dow1*, Sabine Grahl1,4*, Richard Ward2, Rachael Evans1,Olwyn Byron3, David G. Norman2, Tracy Palmer1† and Frank Sargent1†, Dow JM., Grahl S., Ward R., Evans R., Byron O., Norman DG., Palmer T., Sargent F. f.sargent@dundee.ac.uk 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Jennifer M. Dow1*, Sabine Grahl1,4*, Richard Ward2, Rachael Evans1, Olwyn Byron3, David G. Norman2, Tracy Palmer1† and Frank Sargent1† f.sargent@dundee.ac.uk Accepted 2013-OCT-31 by LUANA 2013 imex curation Characterization of a periplasmic nitrate reductase in complex with its biosynthetic chaperone. Characterization of a periplasmic nitrate reductase in complex with its biosynthetic chaperone. The FEBS journal 2013 imex curation Jennifer M. Dow1*, Sabine Grahl1,4*, Richard Ward2, Rachael Evans1,Olwyn Byron3, David G. Norman2, Tracy Palmer1† and Frank Sargent1†, Dow JM., Grahl S., Ward R., Evans R., Byron O., Norman DG., Palmer T., Sargent F. f.sargent@dundee.ac.uk 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Jennifer M. Dow1*, Sabine Grahl1,4*, Richard Ward2, Rachael Evans1, Olwyn Byron3, David G. Norman2, Tracy Palmer1† and Frank Sargent1† f.sargent@dundee.ac.uk Accepted 2013-OCT-31 by LUANA 2013 imex curation napd_ecoli Chaperone NapD yojF napD b2207 JW2195 NapA signal peptide-binding chaperone NapD protein protein ecoli Escherichia coli (strain K12) MHTNWQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAVSLVYHQQEEQGEETP DIP protein P0A9I5 original sequence version: 31 DIP protein P0A9I5 original sequence version: 41 EE59DF4EF17F650D napa_ecoli Periplasmic nitrate reductase yojC yojD yojE napA b2206 JW2194 protein protein ecoli Escherichia coli (strain K12) MKLSRRSFMKANAVAAAAAAAGLSVPGVARAVVGQQEAIKWDKAPCRFCGTGCGVLVGTQQGRVVACQGDPDAPVNRGLNCIKGYFLPKIMYGKDRLTQPLLRMKNGKYDKEGEFTPITWDQAFDVMEEKFKTALKEKGPESIGMFGSGQWTIWEGYAASKLFKAGFRSNNIDPNARHCMASAVVGFMRTFGMDEPMGCYDDIEQADAFVLWGANMAEMHPILWSRITNRRLSNQNVTVAVLSTYQHRSFELADNGIIFTPQSDLVILNYIANYIIQNNAINQDFFSKHVNLRKGATDIGYGLRPTHPLEKAAKNPGSDASEPMSFEDYKAFVAEYTLEKTAEMTGVPKDQLEQLAQLYADPNKKVISYWTMGFNQHTRGVWANNLVYNLHLLTGKISQPGCGPFSLTGQPSACGTAREVGTFAHRLPADMVVTNEKHRDICEKKWNIPSGTIPAKIGLHAVAQDRALKDGKLNVYWTMCTNNMQAGPNINEERMPGWRDPRNFIIVSDPYPTVSALAADLILPTAMWVEKEGAYGNAERRTQFWRQQVQAPGEAKSDLWQLVQFSRRFKTEEVWPEDLLAKKPELRGKTLYEVLYATPEVSKFPVSELAEDQLNDESRELGFYLQKGLFEEYAWFGRGHGHDLAPFDDYHKARGLRWPVVNGKETQWRYSEGNDPYVKAGEGYKFYGKPDGKAVIFALPFEPAAEAPDEEYDLWLSTGRVLEHWHTGSMTRRVPELHRAFPEAVLFIHPLDAKARDLRRGDKVKVVSRRGEVISIVETRGRNRPPQGLVYMPFFDAAQLVNKLTLDATDPLSKETDFKKCAVKLEKV DIP protein P33937 original sequence version: 91 DIP protein P33937 original sequence version: 102 DIP protein P33937 original sequence version: null CE2D7AB000FEAFCA napa-napd-4 3 NapD 4 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role unspecified role unspecified role partially purified partially purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range NapA 5 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role unspecified role unspecified role partially purified partially purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f3 f5 napa-napd-5 1 NapA 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified NapD 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction f6 t1 napa-napd-6 2 NapD 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range NapA 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain tandem tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f2 sf2 sf3 sf4