IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A Cul4 E3 Ubiquitin Ligase Regulates Histone Hand-Off during Nucleosome Assembly. A Cul4 E3 Ubiquitin Ligase Regulates Histone Hand-Off during Nucleosome Assembly. Cell (0092-8674) 2013 imex curation Han J., Zhang H., Zhang H., Wang Z., Zhou H., Zhang Z. Zhang.Zhiguo@mayo.edu 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Han J., Zhang H., Zhang H., Wang Z., Zhou H., Zhang Z. Zhang.Zhiguo@mayo.edu Accepted 2014-JAN-28 by PPORRAS Cell (0092-8674) 2013 Only protein-protein interactions imex curation A Cul4 E3 Ubiquitin Ligase Regulates Histone Hand-Off during Nucleosome Assembly. A Cul4 E3 Ubiquitin Ligase Regulates Histone Hand-Off during Nucleosome Assembly. Cell (0092-8674) 2013 imex curation Han J., Zhang H., Zhang H., Wang Z., Zhou H., Zhang Z. Zhang.Zhiguo@mayo.edu 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Han J., Zhang H., Zhang H., Wang Z., Zhou H., Zhang Z. Zhang.Zhiguo@mayo.edu Accepted 2014-JAN-28 by PPORRAS Cell (0092-8674) 2013 Only protein-protein interactions imex curation A Cul4 E3 Ubiquitin Ligase Regulates Histone Hand-Off during Nucleosome Assembly. A Cul4 E3 Ubiquitin Ligase Regulates Histone Hand-Off during Nucleosome Assembly. Cell (0092-8674) 2013 imex curation Han J., Zhang H., Zhang H., Wang Z., Zhou H., Zhang Z. Zhang.Zhiguo@mayo.edu 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Han J., Zhang H., Zhang H., Wang Z., Zhou H., Zhang Z. Origin of histone proteins obtained from the authors. Interactions using the generic anti-H3 antibodies could not be captured as these cannot be linked with a single gene product. Zhang.Zhiguo@mayo.edu Accepted 2014-JAN-28 by PPORRAS Cell (0092-8674) 2013 Only protein-protein interactions imex curation h4_yeast Histone H4 N2752 YBR0122 YBR009C YNL030W HHF1 HHF2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 69B7D1F89E62DE41 69B7D1F89E62DE41 cnot7_human CCR4-NOT transcription complex subunit 7 CNOT7 CAF1 CCR4-associated factor 1 BTG1-binding factor 1 Caf1a protein protein human Homo sapiens Human MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS DIP protein Q9UIV1 original sequence version: 95 2AF23ED27E06EFDB rt106_yeast Histone chaperone RTT106 Regulator of Ty1 transposition protein 106 YNL206C N1346 RTT106 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKLFLDELPESLSRKIGTVVRVLPSSLEIFEELYKYALNENSNDRSGRHKKPRIDVSSDLLKTDEISETNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLNKNIKMASFLPVPEKPNLIYLFMTYTSCEDNKFSEPVVMTLNKENTLNQFKNLGLLDSNVTDFEKCVEYIRKQAILTGFKISNPFVNSTLVDTDAEKINSFHLQCHRGTKEGTLYFLPDHIIFGFKKPILLFDASDIESITYSSITRLTFNASLVTKDGEKYEFSMIDQTEYAKIDDYVKRKQMKDKSMSEELKAKSKSKGQATDGTADQPSILQEATRQMQDEKKAGVFSDDDEENDQNFEAESDLSDGSGQESSDGAEDGEEAEEDDEEDDEEEDKKGQSALNRDNSFASINGQPEQELQYKEFKEPLELEDIPIEIDNDDDEDDEDGSGVEYD 79CACA659A7F4F4D 79CACA659A7F4F4D h3_yeast Histone H3 SIN2 YNL031C N2749 HHT1 YBR010W YBR0201 HHT2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS A6115FEB480AC67A A6115FEB480AC67A daxx_human Death domain-associated protein 6 DAXX BING2 DAP6 Daxx Fas death domain-associated protein ETS1-associated protein 1 protein protein human Homo sapiens Human MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADTPEASLDSGEGPSGMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDEEEDEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHEKNGKKICTLPSPPSPLASLAPVADSSTRVDSPSHGLVTSSLCIPSPARLSQTPHSQPPRPGTCKTSVATQCDPEEIIVLSDSD 1B309ADDAA878040 hira_human Protein HIRA HIRA TUP1-like enhancer of split protein 1 DGCR1 HIR TUPLE1 protein protein human Homo sapiens Human MKLLKPTWVNHNGKPIFSVDIHPDGTKFATGGQGQDSGKVVIWNMSPVLQEDDEKDENIPKMLCQMDNHLACVNCVRWSNSGMYLASGGDDKLIMVWKRATYIGPSTVFGSSGKLANVEQWRCVSILRNHSGDVMDVAWSPHDAWLASCSVDNTVVIWNAVKFPEILATLRGHSGLVKGLTWDPVGKYIASQADDRSLKVWRTLDWQLETSITKPFDECGGTTHVLRLSWSPDGHYLVSAHAMNNSGPTAQIIEREGWKTNMDFVGHRKAVTVVKFNPKIFKKKQKNGSSAKPSCPYCCCAVGSKDRSLSVWLTCLKRPLVVIHELFDKSIMDISWTLNGLGILVCSMDGSVAFLDFSQDELGDPLSEEEKSRIHQSTYGKSLAIMTEAQLSTAVIENPEMLKYQRRQQQQQLDQKSAATREMGSATSVAGVVNGESLEDIRKNLLKKQVETRTADGRRRITPLCIAQLDTGDFSTAFFNSIPLSGSLAGTMLSSHSSPQLLPLDSSTPNSFGASKPCTEPVVAASARPAGDSVNKDSMNATSTPAALSPSVLTTPSKIEPMKAFDSRFTERSKATPGAPALTSMTPTAVERLKEQNLVKELRPRDLLESSSDSDEKVPLAKASSLSKRKLELEVETVEKKKKGRPRKDSRLMPVSLSVQSPAALTAEKEAMCLSAPALALKLPIPSPQRAFTLQVSSDPSMYIEVENEVTVVGGVKLSRLKCNREGKEWETVLTSRILTAAGSCDVVCVACEKRMLSVFSTCGRRLLSPILLPSPISTLHCTGSYVMALTAAATLSVWDVHRQVVVVKEESLHSILAGSDMTVSQILLTQHGIPVMNLSDGKAYCFNPSLSTWNLVSDKQDSLAQCADFRSSLPSQDAMLCSGPLAIIQGRTSNSGRQAARLFSVPHVVQQETTLAYLENQVAAALTLQSSHEYRHWLLVYARYLVNEGFEYRLREICKDLLGPVHYSTGSQWESTVVGLRKRELLKELLPVIGQNLRFQRLFTECQEQLDILRDK DIP protein P54198 original sequence version: 124 DIP protein P54198 original sequence version: 66 475784B2FF9D16D6 cul8_yeast Cullin-8 RTT101 CUL8 Cullin-C Regulator of Ty1 transposition protein 101 J1166 YJL047C protein protein yeast Saccharomyces cerevisiae Baker's yeast MINESVSKREGFHESISRETSASNALGLYNKFNDERNPRYRTMIAELHEFFHLTLAETITETDVKELECNKEKAAKFRKLMPKMLNNCRELTQRKSYIPYNSEFNGNDEKQKKFQLLHQHQIVLSFQEFCDELAKLIIDAHVLSFLTRCDYSYEIIPKNWTSFYKLFQYVMGAVGPIISYVPVNYPMIRKELGFETLTIFQYYDSKLFECMKSHFGREFSTLVSATIHHYIHMFPITNTMLEKEVPMLRIMSNCNFSIEGLSPKDFYMKTLRQYYCEESNLRPRLETFKNFKVLLTRNALLASLFSPEWVSDANDLFISHLLLNKKSISEYIEIGKDTYDEEKERYFKTETHFSLLMFRNAFEAKNMLSKFKEFCDDAVSEKLKAAYGSNHDTERLFDEVVQLANVDHLKIYSDSIEYHLCNLLGSTSKAIEQYVKYFESHLFIIVRKIKTTKKDLPRDMKIKYLNENLPILRLKFVNLPTFPNFFERSIFRKTILQSDQNSSFIKDILPVYKDSLMELFKQRIITNVSQEDEMRYRDQYQPYLSQFFQPVEVMADLRIKYASFLSFYENIEAAVKFGKTYNENNSKSFFPLIFDRERIPKVFQQSNEVKKNFVLPQEMDDTWNQFLRNYHEQNKVEDSDASKKELYPMWNLHHCEVESPYIIQDGTNLIFELTLFQTCVLTLFNESDHLTLQVISEQTKLAYKDLALVLKSFCNYKILTRDIDNTYSINESFKPDMKKVKNGKLRVVLPRTASLQSSNTGGERTSSAHHEGSNSQWTQELLKACITRSVKSERNGLDYDHLFETVKQQIKGFSVGEFKDALAKLLRDKFITRDESTATYKY A86A48F6DC6AF163 A86A48F6DC6AF163 mms1_yeast E3 ubiquitin-protein ligase linker protein MMS1 Synthetically lethal with MCM10 protein 6 Regulator of Ty1 transposition protein 108 MMS1 KIM3 SLM6 RTT108 YPR164W Methyl methanesulfonate-sensitivity protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLGLRTHGLDRYEHYIRRPSDFGKLELQDWLNHKSFRVSPNLLIDSSTTREWNEPELFYQNTEDETWVRPCVGPKLEPSMMMLRYHDSNIGQMPQFCYPISSPINFKPVLKYILQERSELSDGFPQKYNTLIGSLFDIDKNPETLDDSDIEALDDIEMSSDSGNVKEPKIELQALEEIQQKHFSLIVSNNGIFQTGSTSITYIQSGISGSIAIKPNNVAILILLTQPSGHLLSILPLDDGKETYLLQYWNLGQKGQWNIIKHQNEKQFVLIHKELGICKFFEFHLPFTFQLVNNLTLTDSVIMNGSFFPTNYTDLDPYFIIFITAIRYERIVYFVIEWNNNEIKKKEVYQLTVFDGEKTNMTIPIGLNACLVETPLKFSLVSANQIMSGETEFHSFQLKALKGIKSFFPAPLLLLKLQELHPHTFKKFQYCTIISSSTGNICFCVTERSTIVNGNLKFYELTRFKGLKSISPLPSNPINLDSRSSSYVLVVISFSRTLELTLSLEDLRCLDKKDVIKPLKNITFKHTIDSSTEENSQILAFTSSKFYNTHTGSNINDTRNSQVWLTSPNAITQPCIDYKLRKTHQLIHLKQFQIFRHLRIWKCKNLDIALLQRLGINQSNTESSLIFATDAVSNNRIFLLDLTMTTTIDNDDPVQGLINIEDLLCDTENETILLNFTKNNLIQVTRDTIYIDPIGGDKELRKISPGWEFENVTYNDGILIVWNAGLGCVSYIENIDAVDESGALVSNLSSSKGMSKFFKQLGTVTSVNFQIKESTDDPTKYDIWILLPDCVIRTPFSDWISDSLDFSDVYILSVQQALINGPYFCSLDYESYFEVHTLQNNCFKKGSRCTSRVNFQGKDIKFRSFGVNQCLAFSAFEIFVINLTPIHDSRELDFYKLKLPHLGNNNSILEVCPDIENNQLFILYSDGLRILELSYLTSNNGNFLLKSTRSKNKKFLYLDKINRMLVLNQDLREWECIRLSDGKAVGLDSQLLKDDSEEILEIKELPIATEDNPLEKKTVLLISFTSSLKLVLLTAAKNKISNQIIDSYKLDNSRLLNHLVITPRGEIFFLDYKVMGTDNEMSFNKLKVTKHCIDQEERNNTTLRLTLETRFTFKSWSTVKTFTVVGDNIIATTNMGEKLYLIKDFSSSSDESRRVYPLEMYPDSKVQKIIPLNECCFVVAAYCGNRNDLDSRLIFYSLPTIKVGLNNETGSLPDEYGNGRVDDIFEVDFPEGFQFGTMALYDVLHGERHVNRYSEGIRSENDEAEVALRQRRNLLLFWRNHSSTPKPSLRRAATIVYEDHVSSRYFEDISSILGSTAMRTKRLSPYNAVALDKPIQDISYDPAVQTLYVLMADQTIHKFGKDRLPCQDEYEPRWNSGYLVSRRSIVKSDLICEVGLWNLSDNCKNTV CC698C422631A7D7 CC698C422631A7D7 asf1_yeast Histone chaperone ASF1 ASF1 YJL115W J0755 CIA1 Anti-silencing function protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWDNENEGDLYPPEQPGVDDEEEEDDEEEDDDEDDEDDEDDDQEDGEGEAEEAAEEEEEEEEKTEDNETNLEEEEEDIENSDGDEEEGEEEVGSVDKNEDGNDKKRRKIEGGSTDIESTPKDAARSTN 186E76075C0B1644 186E76075C0B1644 h33_human Histone H3.3 H3-3A H3-3B H3.3A H3.3B H3F3 H3F3A H3F3B PP781 protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA DIP protein P84243 original sequence version: 72 DIP protein P84243 original sequence version: 73 DIP protein P84243 original sequence version: 97 DIP protein P84243 original sequence version: 125 DIP protein P84243 original sequence version: 110 DIP protein P84243 original sequence version: 96 5158ED279E6F9E1C cac2_yeast Chromatin assembly factor 1 subunit p60 CAC2 CAF-1 60 kDa subunit YML102W protein protein yeast Saccharomyces cerevisiae Baker's yeast MEASHLQIYWHDSQPVYSLTFQKNSANDKLFTAGGDNKVRIWKLNRDENGQNGGVRKIESLDFLGSLTHHEQAINVIRFNSKGDVLASAGDDGQVLLWKQEDPNTQQESVVRPFGMDAETSEADENKEKWVVWKRLRGGSGATAAAEIYDLAWSPDNRNIVVACMDNSIRLFDVGAGMLVCGQSDHGHYVQGVAWDPLNQFILSQSADRSLHVYGVILSSAGVVTGLKLRSKIAKAELPCPGDVLRTNYLFHNETLPSFFRRCSISPCGGLVVIPSGVYKVAGDEVANCVYVYTRSGILNSAGGVKNRPAIRIPSLKKPALMAAFSPVFYETCQKSVLKLPYKLVFAIATTNEVLVYDTDVLEPLCVVGNIHYSPITDLAWSEDGSTLLISSTDGFCSYVSIDTETQFGSRIEPPAMHAEPLDTDESAVAAKNQREAGGIVNMLPVKKIPCNSSDSKKRRIHPTPVDL F24853C4AA4D97C2 F24853C4AA4D97C2 h3_drome Histone H3 His3 His3:CG31613 His3:CG33857 His3:CG33860 His3:CG33863 His3:CG33866 CG31613 CG33803 CG33806 CG33809 CG33812 CG33815 CG33818 CG33821 CG33824 CG33827 CG33830 CG33833 CG33836 CG33839 CG33842 CG33845 CG33848 CG33851 CG33854 CG33857 CG33860 CG33863 CG33866 His3:CG33803 His3:CG33806 His3:CG33809 His3:CG33812 His3:CG33815 His3:CG33818 His3:CG33821 His3:CG33824 His3:CG33827 His3:CG33830 His3:CG33833 His3:CG33836 His3:CG33839 His3:CG33842 His3:CG33845 His3:CG33848 His3:CG33851 His3:CG33854 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA DIP protein P02299 original sequence version: 100 6FD8508EA50A0EEC h31_human Histone H3.1 H3FA H3FL H3FD H3FI H3FH H3FK H3FF H3FJ H3FB Histone H3/a Histone H3/b Histone H3/c Histone H3/d Histone H3/f Histone H3/h Histone H3/i Histone H3/j Histone H3/k Histone H3/l H3C1 HIST1H3A H3C2 HIST1H3B H3C3 H3FC HIST1H3C H3C4 HIST1H3D H3C6 HIST1H3E H3C7 HIST1H3F H3C8 HIST1H3G H3C10 HIST1H3H H3C11 HIST1H3I H3C12 HIST1H3J protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA DIP protein P68431 original sequence version: 78 DIP protein P68431 original sequence version: 79 DIP protein P68431 original sequence version: 76 DIP protein P68431 original sequence version: 92 DIP protein P68431 original sequence version: 87 DIP protein P68431 original sequence version: 101 DIP protein P68431 original sequence version: 130 DIP protein P68431 original sequence version: 115 9B89008EA50A0EF6 hht1-rtt101 2 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1E, 1F, 2C The amount of Rtt101 coimmunoprecipitated with H3 was dramatically reduced in mms1-/- and to a lesser extent in mms22-/- mutant cells compared to wild-type cells. Interaction not observed in Rtt109 -/- or Asf1 -/- cells. hhf1-rtt101 2 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1E rtt101-his3 1 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role prey prey lys-57 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association Fig. 1G, 2D hhf1-hht1-4 2 7 unspecified role unspecified role prey prey lys-123 ubiquitinylated lysine ubiquitinylated lysine certain certain sequence position certain certain certain sequence position certain lys-57 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3C, 3F, Supp Fig. 1B The apparent molecular weight of the H3K122ub proteins corresponds to one histone H3 conjugated with two and six ubiquitin molecules (H3-Ub2 and H3-Ub6), respectively. asf1-hhf1-6 2 7 unspecified role unspecified role prey prey lys-57 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey lys-6_lys-13 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 6A Cells lacking Rtt101 or expressing H3 with mutated lysine residues exhibit an increased association of Asf1 with H3-H4. asf1-his3-1 1 12 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey lys-57 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 6B Asf1 bound less H3-H4 molecules when ubiquitylated by the Rtt101Mms1 E3 ligase than unmodified H3-H4 in vitro rtt106-hhf1 2 7 unspecified role unspecified role prey prey lys-57 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey lys-6_lys-13 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 6C Cells lacking Rtt101 or expressing H3 with mutated lysine residues exhibit an increased association of Asf1 with H3-H4. rtt106-his3-1 1 15 unspecified role unspecified role prey prey region ubiquitinylated lysine ubiquitinylated lysine undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6D Asf1-H3K56ac-H4 proteins were immobilized, ubiquitylated then incubated with GST-Rtt106. More H3 from the immobilized Asf1-H3-H4 complex were transferred to Rtt106 when H3 was ubiquitylated cac2-hhf1 2 7 unspecified role unspecified role prey prey lys-57 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey lys-6_lys-13 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp. Fig. 4D hist1h3a-cnot7 3 5 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figs. 7E, 7F, Supp. FIg. 6F, 6G Depletion of Cul4Aand DDB1 led to a marked reduction in the interaction between H3.1 and CAF-1 CAF-1 was identified as both a p150 and p60 species. h3f3a-daxx 3 13 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association Fig. 7E, 7F, Supp. Fig 6F, 6G Depletion of Cul4A and DDB1 led to a marked reduction in the interaction between H3.3 and its specific chaperones Daxx and HIRA.