IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ MEF2 Is an In Vivo Immune-Metabolic Switch. MEF2 Is an In Vivo Immune-Metabolic Switch. Cell (0092-8674) 2013 imex curation Clark R.I., Tan S.W., Péan C.B., Roostalu U., Vivancos V., Bronda K., Pilátová M., Fu J., Walker D.W., Berdeaux R., Geissmann F., Dionne M.S. EMSA not captured as only partial sequence marc.dionne@kcl.ac.uk 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Clark R.I., Tan S.W., Péan C.B., Roostalu U., Vivancos V., Bronda K., Pilátová M., Fu J., Walker D.W., Berdeaux R., Geissmann F., Dionne M.S. EMSA not captured as only partial sequence marc.dionne@kcl.ac.uk Accepted 2013-NOV-25 by MGT Cell (0092-8674) 2013 Only protein-protein interactions imex curation MEF2 Is an In Vivo Immune-Metabolic Switch. MEF2 Is an In Vivo Immune-Metabolic Switch. Cell (0092-8674) 2013 imex curation Clark R.I., Tan S.W., Péan C.B., Roostalu U., Vivancos V., Bronda K., Pilátová M., Fu J., Walker D.W., Berdeaux R., Geissmann F., Dionne M.S. EMSA not captured as only partial sequence marc.dionne@kcl.ac.uk 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Clark R.I., Tan S.W., Péan C.B., Roostalu U., Vivancos V., Bronda K., Pilátová M., Fu J., Walker D.W., Berdeaux R., Geissmann F., Dionne M.S. EMSA not captured as only partial sequence marc.dionne@kcl.ac.uk Accepted 2013-NOV-25 by MGT Cell (0092-8674) 2013 Only protein-protein interactions imex curation tbp_drome TATA-box-binding protein Tbp BTF1 TFIID CG9874 TATA-box factor TATA-binding factor TATA sequence-binding protein Transcription initiation factor TFIID TBP subunit protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDQMLSPNFSIPSIGTPLHQMEADQQIVANPVYHPPAVSQPDSLMPAPGSSSVQHQQQQQQSDASGGSGLFGHEPSLPLAHKQMQSYQPSASYQQQQQQQQLQSQAPGGGGSTPQSMMQPQTPQSMMAHMMPMSERSVGGSGAGGGGDALSNIHQTMGPSTPMTPATPGSADPGIVPQLQNIVSTVNLCCKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEDDSRLAARKYARIIQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHCNFSSYEPELFPGLIYRMVRPRIVLLIFVSGKVVLTGAKVRQEIYDAFDKIFPILKKFKKQS DIP protein P20227 original sequence version: 134 DIP protein P20227 original sequence version: 99 DIP protein P20227 original sequence version: 135 7B079BC01BAF69BC mef2_drome Myocyte-specific enhancer factor 2 Mef2 CG1429 MADS domain transcription factor protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRVLLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPEAETDYTLTPRTEAKYNKIDEEFQNMMQRNQMAIGGAGAPRQLPNSSYTLPVSVPVPGSYGDNLLQASPQMSHTNISPRPSSSETDSGGMSLIIYPSGSMLEMSNGYPHSHSPLVGSPSPGPSPGIAHHLSIKQQSPGSQNGRASNLRVVIPPTIAPIPPNMSAPDDVGYADQRQSQTSLNTPVVTLQTPIPALTSYSFGAQDFSSSGVMNSADIMSLNTWHQGLVPHSSLSHLAVSNSTPPPATSPVSIKVKAEPQSPPRDLSASGHQQNSNGSTGSGGSSSSTSSNASGGAGGGGAVSAANVITHLNNVSVLAGGPSGQGGGGGGGGSNGNVEQATNLSVLSHAQQHHLGMPNSRPSSTGHITPTPGHDKYEGYPYRALMGHNPRWNLNFAGAPSSDQDVRLAAVAVQQQQQQPHQQQQLGDYDAPNHKRPRISGGWGT 0B82D0C61EE1899E mef2-tbp 2 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Fig. 5B In adult flies infected with the imd (CG5576) agonist E. cloacae or a mixture of M. luteus and E. coli, TBP coimmunoprecipitated with MEF2. When stimulated by E. cloacae, this association required the imd-activated JNKKK Tak1 but was unimpaired in Dif; Rel double mutants, suggesting a requirement for JNK signaling, but not NF-κB, in MEF2-TBP complex formation after Gram-negative infection mef2-tbp-1 1 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P40791:p.Thr20Ala mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain T A Wed May 02 15:55:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr20ala' Tue Jun 30 18:20:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr20Ala' P40791:p.Thr20Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T E Wed May 02 17:52:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr20glu' Tue Jun 30 19:10:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr20Glu' physical association physical association Fig. 6D A mixture of M. luteus and E. coli