MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Hepatitis B virus core protein interacts with CD59 to promote complement-mediated liver inflammation during chronic hepatitis B virus infection Hepatitis B virus core protein interacts with CD59 to promote complement-mediated liver inflammation during chronic hepatitis B virus infection FEBS Lett. (0014-5793) 2013 imex curation Liu D., Ni B., Wang L., Zhang M., Liu W., Wu Y. wei.liu.2005@gmail.com 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu D., Ni B., Wang L., Zhang M., Liu W., Wu Y. wei.liu.2005@gmail.com Accepted 2013-AUG-29 by LPERFETTO 30-Sept-2013: Contacted by IntAct-Help. FEBS Lett. (0014-5793) 2013 Only protein-protein interactions imex curation Hepatitis B virus core protein interacts with CD59 to promote complement-mediated liver inflammation during chronic hepatitis B virus infection Hepatitis B virus core protein interacts with CD59 to promote complement-mediated liver inflammation during chronic hepatitis B virus infection FEBS Lett. (0014-5793) 2013 imex curation Liu D., Ni B., Wang L., Zhang M., Liu W., Wu Y. wei.liu.2005@gmail.com 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). confocal microscopy confocal microscopy immunostaining immunostaining Liu D., Ni B., Wang L., Zhang M., Liu W., Wu Y. wei.liu.2005@gmail.com Accepted 2013-AUG-29 by LPERFETTO 30-Sept-2013: Contacted by IntAct-Help. FEBS Lett. (0014-5793) 2013 Only protein-protein interactions imex curation Hepatitis B virus core protein interacts with CD59 to promote complement-mediated liver inflammation during chronic hepatitis B virus infection Hepatitis B virus core protein interacts with CD59 to promote complement-mediated liver inflammation during chronic hepatitis B virus infection FEBS Lett. (0014-5793) 2013 imex curation Liu D., Ni B., Wang L., Zhang M., Liu W., Wu Y. wei.liu.2005@gmail.com 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). tap tandem affinity purification TAP TAP tap de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Liu D., Ni B., Wang L., Zhang M., Liu W., Wu Y. wei.liu.2005@gmail.com Accepted 2013-AUG-29 by LPERFETTO 30-Sept-2013: Contacted by IntAct-Help. FEBS Lett. (0014-5793) 2013 Only protein-protein interactions imex curation stn1_human CST complex subunit STN1 STN1 OBFC1 Oligonucleotide/oligosaccharide-binding fold-containing protein 1 Suppressor of cdc thirteen homolog protein protein human Homo sapiens Human MQPGSSRCEEETPSLLWGLDPVFLAFAKLYIRDILDMKESRQVPGVFLYNGHPIKQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESVSAAPSAARELSLTSQLKKLQETIEQKTKIEIGDTIRVRGSIRTYREEREIHATTYYKVDDPVWNIQIARMLELPTIYRKVYDQPFHSSALEKEEALSNPGALDLPSLTSLLSEKAKEFLMENRVQSFYQQELEMVESLLSLANQPVIHSASSDQVNFKKDTTSKAIHSIFKNAIQLLQEKGLVFQKDDGFDNLYYVTREDKDLHRKIHRIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQVLELLEDQSDIVSTMEHYYTAF DIP protein Q9H668 original sequence version: 89 087E7EF75544A1F0 q778i9_hbv Capsid protein Core antigen Core protein HBcAg p21.5 HBVgp4 C core protein protein hbv Hepatitis B virus (HBV) HBV MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC E0D9D9763F24E958 cd59_human CD59 glycoprotein CD59 Membrane attack complex inhibition factor MAC-inhibitory protein Protectin MEM43 antigen Membrane inhibitor of reactive lysis 20 kDa homologous restriction factor 1F5 antigen MIC11 MIN1 MIN2 MIN3 MSK21 protein protein human Homo sapiens Human MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP 2F0D29CBE3C28505 tpm1_human Tropomyosin alpha-1 chain TPM1 TMSA Tropomyosin-1 Alpha-tropomyosin C15orf13 protein protein human Homo sapiens Human MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI F57139E2B0972F4D c-cd59 3 CD59 6 unspecified role unspecified role prey prey living cell living cell TPM1 7 unspecified role unspecified role prey prey living cell living cell HBc 5 unspecified role unspecified role bait bait living cell living cell tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range OBFC1 4 unspecified role unspecified role prey prey living cell living cell association association f1a f1b c-cd59-1 1 HBc 5 unspecified role unspecified role bait bait living cell living cell CD59 6 unspecified role unspecified role prey prey living cell living cell physical association physical association f1c cd59-c 1 CD59 6 unspecified role unspecified role bait bait living cell living cell HBc 5 unspecified role unspecified role prey prey living cell living cell physical association physical association f1c c-cd59-2 2 HBc 5 unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell CD59 6 unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell colocalization colocalization f5