MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it UXT plays dual opposing roles on SARM-induced apoptosis UXT plays dual opposing roles on SARM-induced apoptosis FEBS Lett. (0014-5793) 2013 imex curation Sethurathinam S., Singh L.P., Panneerselvam P., Byrne B., Ding J.L. dbsdjl@nus.edu.sg 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sethurathinam S., Singh L.P., Panneerselvam P., Byrne B., Ding J.L. dbsdjl@nus.edu.sg Accepted 2013-AUG-29 by LPERFETTO 30-Sept-2013: Contacted by IntAct-Help. FEBS Lett. (0014-5793) 2013 Only protein-protein interactions imex curation UXT plays dual opposing roles on SARM-induced apoptosis UXT plays dual opposing roles on SARM-induced apoptosis FEBS Lett. (0014-5793) 2013 imex curation Sethurathinam S., Singh L.P., Panneerselvam P., Byrne B., Ding J.L. dbsdjl@nus.edu.sg 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sethurathinam S., Singh L.P., Panneerselvam P., Byrne B., Ding J.L. dbsdjl@nus.edu.sg Accepted 2013-AUG-29 by LPERFETTO 30-Sept-2013: Contacted by IntAct-Help. FEBS Lett. (0014-5793) 2013 Only protein-protein interactions imex curation q0d2n8_human NAD(+) hydrolase SARM1 SARM1 NADP(+) hydrolase SARM1 Sterile alpha and TIR motif-containing protein 1 protein protein human Homo sapiens Human FFAMSGPRPGAERLAVPGPDGGGGTGPWWAAGGRGPREVSPGAGTEVQDALERALPELQQALSALKQAGGARAVGAGLAEVFQLVEEAWLLPAVGREVAQGLCDAIRLDGGLDLLLRLLQAPELETRVQAARLLEQILVAENRDRVARIGLGVILNLAKEREPVELARSVAGILEHMFKHSEETCQRLVAAGGLDAVLYWCRRTDPALLRHCALALGNCALHGGQAVQRRMVEKRAAEWLFPLAFSKEDELLRLHACLAVAVLATNKEVEREVERSGTLALVEPLVASLDPGRFARCLVDASDTSQGRGPDDLQRLVPLLDSNRLEAQCIGAFYLCAEAAIKSLQGKTKVFSDIGAIQSLKRLVSYSTNGTKSALAKRALRLLGEEVPRPILPSVPSWKEAEVQTWLQQIGFSKYCESFREQQVDGDLLLRLTEEELQTDLGMKSGITRKRFFRELTELKTFANYSTCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIHLGVHRARILTAAREMLHSPLPCTGGKPSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGRSSRDSSAGSDTSLEGAAPMGPT 53A806C0108C8938 uxt_human Protein UXT UXT HSPC024 Ubiquitously expressed transcript protein Androgen receptor trapped clone 27 protein protein protein human Homo sapiens Human MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH 94CE14C462DEE308 sarm1-uxt 1 SARM 3 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined UTX 4 unspecified role unspecified role prey prey cdna library cdna library tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1a sarm1-uxt-3 2 UTX 4 unspecified role unspecified role prey prey living cell living cell tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SARM 3 unspecified role unspecified role bait bait living cell living cell tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1b We expressed SARM, UXT V1 or UXT V2 in HEK 293T cells to further assess their interactions by coimmunoprecipitation. Consistently, SARM was detected in both the UXT -V1 and -V2 10 immunoprecipitates and conversely, UXT -V1 and -V2 were detected in SARM immunoprecipitates (Fig. 1B), supporting that SARM interacts with both UXT isoforms.