IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Exploitation of Latent Allostery Enables the Evolution of New Modes of MAP Kinase Regulation. Exploitation of Latent Allostery Enables the Evolution of New Modes of MAP Kinase Regulation. Cell (0092-8674) 2013 imex curation Coyle S.M., Flores J., Lim W.A. The Fus3 orthologues from V. pol and Z. rou indicated in Fig. 3a and Fig. 3b could not be unambiguously mapped to a uniprot ID, hence these interactions were not curated for this experiment. lim@cmp.ucsf.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Coyle S.M., Flores J., Lim W.A. The Fus3 orthologues from V. pol and Z. rou indicated in Fig. 3a and Fig. 3b could not be unambiguously mapped to a uniprot ID, hence these interactions were not curated for this experiment. lim@cmp.ucsf.edu Accepted 2013-NOV-22 by PPORRAS Cell (0092-8674) 2013 Only protein-protein interactions imex curation Exploitation of Latent Allostery Enables the Evolution of New Modes of MAP Kinase Regulation. Exploitation of Latent Allostery Enables the Evolution of New Modes of MAP Kinase Regulation. Cell (0092-8674) 2013 imex curation Coyle S.M., Flores J., Lim W.A. The Fus3 orthologues from V. pol and Z. rou indicated in Fig. 3a and Fig. 3b could not be unambiguously mapped to a uniprot ID, hence these interactions were not curated for this experiment. lim@cmp.ucsf.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Coyle S.M., Flores J., Lim W.A. The Fus3 orthologues from V. pol and Z. rou indicated in Fig. 3a and Fig. 3b could not be unambiguously mapped to a uniprot ID, hence these interactions were not curated for this experiment. lim@cmp.ucsf.edu Accepted 2013-NOV-22 by PPORRAS Cell (0092-8674) 2013 Only protein-protein interactions imex curation c5dsp8_zygrc ZYRO0C02002g protein protein zygrc Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) MQAPEDNIIYQLTNIGASQQPSQQRSPLKTPKASSAGSTPSRDGSITPSPSSRGKKWADRFAKFQRHSDKKRTAHSPSTNRGVSISPVVSQTLSPLGNSHGLRTSSLPRPPDTFEFGLNLTPPPKMGPFSHRRSNTSNKKSFLNEYCTVCDEPILNRGSGERIIELECGHISHQECLLVSFENSGGYSPNDFFSIFPPCTKCHNDKNIENRCIPKNAELKDRLISIFLINGSARRHSEPSTSPTQQLQPPLVLNNFPTLQQTPHISSPRGQMSSQAIPSAQNHALRTPDSILGGMRLASVPPKARKKSAPEIRREWPVPQFQPSIRVSLVLQPDTKNYSVSTSDKLQLYVLRAHYIEILMKNFPTLSDWQIDEEFGLLRLVDHLMMSRDGVDYNDCWCMLFEKALVVAPLADGVKTKQDGSLNVKLKEFHVYKSVANVRVDTVESSVLKWTFPKTEFSSWQEVYVTETLNTDASQVIQKWISALLDHEQEFNDKYFTSTLPLPPIMRNDTQSSHLSTSLMGLITPTKMVELASNERSSVIIRRGFKLSEEQGATLSATGSIQSAMTNISSILSLKRERPDELVVVLQLDFEKIRTKNNSLVIFNSLKALVLKFPDMKICIVDSGGFVRTLGRTKDVISTVEDLEDAQKLSEGNRFEPIWLKNSLYPDTTLKGLGIAIVSNTPMDTQKSCLLKDYSCFTNEGRRRPRELKIKVGYLNLDYSDKVGELVELESWNNFLEALSYSFGLAFGDDDDDDVSSIEEDLTDSENEHPLDDTRSMSSNESTTTILIASPFDASESNARSILGDNEDSHFATGSYSSSLKPSVNSYPQERYREKAPNKNIQDGCDFLLEDIERAIREIDQVSSPSHTESSSHPSVLYQYL FB3B050E9361D4BC q6cnr3_klula Mitogen-activated protein kinase KLLA0_E10539g protein protein klula Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) Yeast Candida sphaerica MGKRIVFNISSEFQLQSLLGEGAYGVVCSAKHKPSGEIVAIKKIEPFEKPLFSIRTLREIKILKHFQHENIISIFDVQKPSSFEQFNEVYIIQELMQTDLHRVIVTQELSEDHVQYFVYQTLRALKVLHGSNVIHRDLKPSNLLLNSNCDLKICDFGLARIVSERATDGDAHVDADDTDDNSPSSAANDGDPAISGMTEYVATRWYRAPEVMLTAAQYSKSMDVWSCGCILAELLGKQPLFPGKDYRDQLILIFQTLGTPTEQELVELVENRRAREYIRSLPKHPKINWRRRFPNASAAALDLLDRMLQFDPRLRITATEALSHPYLVSYHDPDDEPEGTPIPSSFFQFDQWKSRLNTKDLKRLLWNEIVS CCB9C22D3F2DEA99 q6fl43_canga RING-type domain-containing protein CAGL0L06336g protein protein canga Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) Yeast Torulopsis glabrata MFHRFHLRKKQVSSHEISPEAKVEYKFIRSDKRSFINHICTLCDEPIAYKSGGEKVIELECGHMCHMDCLMLFVNSTALPICKYCKKFNNRAKECIPKENCLKDTLISQYLVNNKMNSPVHETSHKSIDKHSNQKYTSSTSQNKEEYPIHLLRTFFSDWFINQSKEYTTITPWELDHNFGLLRLVDKFEISYYPFIKKKLAVCLLFENILAIVQVQRESIKCNEFSEIHAESIHLYHTENSRADLKYQKIDYINCQIRKADYTGNKLRISLSNTTLRMFEIETEKNGVLLNWLRGFHDKKQMFDAKYFTSNCLELPVMQIFENESTILGLFNSNRLIEMGSINSVHNSIILRRSFYLRNSMETDIMGTYNTITSSVLSIKKEKPSDILLLIQIDEQKITDQKDQIKQVIKNTLMALKLKYPEYFLVILSATGEVLLMDSIDRLNLDNQLLSGEEPKNPFRLEISSIRTHVYGTSILENLAIVAVSNSAMVETTSILFKNFSPLISKGRLRPNEIRIKVGYSNNDYSDVVSELVEIESWDYLLEALCHTFSLDYDDDYTSYETSYDINSLEADSVTTLEIESPFKYDHLYTNVGNHSSENI F594FB8783E55167 a5e0p6_lodel Mitogen-activated protein kinase LELG_03183 protein protein lodel Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) MTATSVITKANKVRHAYRKPQPDPSTRKIVFNISPNFKVESVLGEGAYGIVALAVHLPTKTKVAIKKIEPFERPLFCLRTLREIKLLRKFNNHENIIRLYDLQKPSSFATFNEVYLIQEYMPSDLHNIIQTHVLSDQHVQFFIYQILKGLKLIHSAKVIHRDLKPSNILVNENCDLKICDFGLARVDSVNYRTDKISSLTEYVATRWYRAPEIMLNVSNYTTAIDLWSVGCILFELLIYRAIFPGADYINQLKLIFEILGTPSEDDLKVIKSKRARTFIQSLPVRQKVNLTEFVQLHPCRRAKHHEFAGEVNPMAIDLLEKLLVFDPSRRITVTEALEHPYLSTYHDPLDEPVTLPVRLEDFDFDVEKKDLDLDDLKRQIYNQIVESKRIETN EFC36AE3BF0B5F38 q75cv7_ashgo Mitogen-activated protein kinase AGOS_ACL191C protein protein ashgo Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) MPRTITFDIPSHYKLVDLIGEGAYGIVCSAIHKPTGTKVAIKKIQPFTRPMFVTRTLRELKLLKFFHSHENIISVLDIVRPTSYQDFEAVYLVQELMETDLQRIISQPNSFLSDDHIQYFTYQILRALKSLHSAQVIHRDLKPSNLLLNSSCDLKLCDFGLSRCLASSDRSRENMVGFMTEYVATRWYRAPEIMLSFQEYTTAMDIWSCGCILAEMISGKPLFPGRDYHHQLWIILEILGTPSFEDFEQIKSKRAKAYIANLPMRPKIPWNVALSTNDINPLAMDLLDKMLTFNPDKRISAADALKHPYLETYHDAEDEPDYELLNLQDNFWKVDNEARQKTEEEELSMDTLKAMLYEEVMKPLQ 9CE196D142AF1E90 ste7_yeast Serine/threonine-protein kinase STE7 STE7 D1525 YDL159W protein protein yeast Saccharomyces cerevisiae Baker's yeast MFQRKTLQRRNLKGLNLNLHPDVGNNGQLQEKTETHQGQSRIEGHVMSNINAIQNNSNLFLRRGIKKKLTLDAFGDDQAISKPNTVVIQQPQNEPVLVLSSLSQSPCVSSSSSLSTPCIIDAYSNNFGLSPSSTNSTPSTIQGLSNIATPVENEHSISLPPLEESLSPAAADLKDTLSGTSNGNYIQLQDLVQLGKIGAGNSGTVVKALHVPDSKIVAKKTIPVEQNNSTIINQLVRELSIVKNVKPHENIITFYGAYYNQHINNEIIILMEYSDCGSLDKILSVYKRFVQRGTVSSKKTWFNELTISKIAYGVLNGLDHLYRQYKIIHRDIKPSNVLINSKGQIKLCDFGVSKKLINSIADTFVGTSTYMSPERIQGNVYSIKGDVWSLGLMIIELVTGEFPLGGHNDTPDGILDLLQRIVNEPSPRLPKDRIYSKEMTDFVNRCCIKNERERSSIHELLHHDLIMKYVSPSKDDKFRHWCRKIKSKIKEDKRIKREALDRAKLEKKQSERSTH C8A75899CFBE8BDE C8A75899CFBE8BDE q74zu4_ashgo AGOS_AGR104W protein protein ashgo Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) MVVRPDISLPLNSLGPAMDFNPPVTPSTDKPPSSSESSPLVNATPRSGRRWTERLVPKRKRVLHSPEQIRSATQERRPVSALVSPVTDFPLRSTSITTPPRFQNDIGFLSTQRQNAPVMSPMPFMGELTAESFLSPKKSIVNARCCLCDEPVSTRSNGERIITLECDHSCHEDCLLVFLEENSSDASKKPNEEDDIYAVFPACKACEYSSGVNKCIPKDDTLRDKLISQYLIKRTKPVLRSHIPRVPPIEIPPTKPARPFGLQNPKRSVQRPTPLALTSLTLLSPPRKRNGSVTSSISSLASSVQLKGGDPSAEASTRYLALLRSYFVQSLFVNYPDWEVDSSFGLLRLVDSFTCSRENDPEGYQDSVLYLFEHRLVAGIPVTKPKHTMVGVKFSSIWDYDISSFRVDTLQSSVLKLTFDNDTIYISEGVSSNTTKVLEKWISALLNIEMPVNSTNFTSTLPLPDLDDESVGSIRRSDIMVRATDVNDSVIVRRGLYTHEKSLTRNAESTMMRASINSILSLKRRHPDELCLFFQIDTAKVQAVDYKILANTCKAILWKFNTAKVALADSNGGIVTMSLLKDFIPIFSSIDHILRRHETRRKLSPNLVYRHFYGKERLKNVGVCIISNSAMQYGKSLLLMDYSAFCNIGKKRPNELKVKVGYLNTDYSDQVFELVETGGWGDVLEVVCYSFNMAFGQDDYSDDDETEDYITEDDITDSDSIHDQQPTFPIAKNSIDTPIIADASYLLDSDRESIIDPDQSGSVRSLQLQAYSASGSRNSPTSGYLGISTHHPLSASGAWSSLITDLDNALNEVVANTPSPAVSSNNSGEYSYL 7448F0ABAF656A90 q6cy79_klula Mitogen-activated protein kinase KLLA0_A02497g protein protein klula Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) Yeast Candida sphaerica MPRTITYDIPSHYQLVDLVGEGAYGTVCSAIHKPTNTKVAIKKIQPFSRSMFVTRTLRELKLLKFFHSHENIISVLDIVRPTSWHKFEAVYLVQELMETDLQKIINQQNLSEDHIQYFVYQILRALKSLHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLARCLASSDQSRENMVGFMTEYVATRWYRAPEIMLSFQEYTTAMDIWSCGCILAEMIMGKPLFPGKDYHHQLWIILEVLGSPTLEDFEQIKSKRAKEYISQLPMKKGIPWANVLNKEVNPLAIDLLSKMLTFNPDKRISAVEALEHPYLATYHDPDDEPDYPQLNLEDNFWKIDNEARDKNEEDDIPLELLKKMLYGEVMKPLN 8A51D48F594D8A03 spk1_schpo Mitogen-activated protein kinase spk1 spk1 SPAC31G5.09c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MASATSTPTIADGNSNKESVATSRSPHTHDLNFELPEEYEMINLIGQGAYGVVCAALHKPSGLKVAVKKIHPFNHPVFCLRTLREIKLLRHFRHENIISILDILPPPSYQELEDVYIVQELMETDLYRVIRSQPLSDDHCQYFTYQILRALKAMHSAGVVHRDLKPSNLLLNANCDLKVADFGLARSTTAQGGNPGFMTEYVATRWYRAPEIMLSFREYSKAIDLWSTGCILAEMLSARPLFPGKDYHSQITLILNILGTPTMDDFSRIKSARARKYIKSLPFTPKVSFKALFPQASPDAIDLLEKLLTFNPDKRITAEEALKHPYVAAYHDASDEPTASPMPPNLVDLYCNKEDLEIPVLKALIFREVNFR 85D980514C9386C7 ste5_yeast Protein STE5 STE5 NUL3 YDR103W YD8557.12 protein protein yeast Saccharomyces cerevisiae Baker's yeast MMETPTDNIVSPFHNFGSSTQYSGTLSRTPNQIIELEKPSTLSPLSRGKKWTEKLARFQRSSAKKKRFSPSPISSSTFSFSPKSRVTSSNSSGNEDGNLMNTPSTVSTDYLPQHPHRTSSLPRPNSNLFHASNSNLSRANEPPRAENLSDNIPPKVAPFGYPIQRTSIKKSFLNASCTLCDEPISNRRKGEKIIELACGHLSHQECLIISFGTTSKADVRALFPFCTKCKKDTNKAVQCIPENDELKDILISDFLIHKIPDSELSITPQSRFPPYSPLLPPFGLSYTPVERQTIYSQAPSLNPNLILAAPPKERNQIPQKKSNYTFLHSPLGHRRIPSGANSILADTSVALSANDSISAVSNSVRAKDDETKTTLPLLRSYFIQILLNNFQEELQDWRIDGDYGLLRLVDKLMISKDGQRYIQCWCFLFEDAFVIAEVDNDVDVLEIRLKNLEVFTPIANLRMTTLEASVLKCTLNKQHCADLSDLYIVQNINSDESTTVQKWISGILNQDFVFNEDNITSTLPILPIIKNFSKDVGNGRHETSTFLGLINPNKVVEVGNVHDNDTVIIRRGFTLNSGECSRQSTVDSIQSVLTTISSILSLKREKPDNLAIILQIDFTKLKEEDSLIVVYNSLKALTIKFARLQFCFVDRNNYVLDYGSVLHKIDSLDSISNLKSKSSSTQFSPIWLKNTLYPENIHEHLGIVAVSNSNMEAKKSILFQDYRCFTSFGRRRPNELKIKVGYLNVDYSDKIDELVEASSWTFVLETLCYSFGLSFDEHDDDDEEDNDDSTDNELDNSSGSLSDAESTTTIHIDSPFDNENATANMVNDRNLLTEGEHSNIENLETVASSVQPALIPNIRFSLHSEEEGTNENENENDMPVLLLSDMDKGIDGITRRSSFSSLIESGNNNCPLHMDYI 0435BDA0196B2D6F 0435BDA0196B2D6F c5m3m0_cantt Mitogen-activated protein kinase CTRG_00659 protein protein cantt Candida tropicalis (strain ATCC MYA-3404 / T1) MARLPDVKESRQVVFNISQNFKVIKILGEGAYGIVALAVHIPTGTKVAIKKIEPFERPLFCLRTLREIKLLNKFKCHENIIRLYDVQKPLDYAHFNEVYLIQEYMPSDLHNIIYTHVLSDQHVQYFIYQILKGLKLMHSAKVIHRDLKPSNILVNEQCDLKICDFGLARLDAKHYNLETNPKISMLTEYVATRWYRAPEIMLSASNYSTAIDLWSVGCILAELLTYKALFPGTDYINQLRLIFEVLGSPSDEDLKIIKSERAQKFVKSLPYRVKIDLTDFVNNHPYRRIKVRARETVNPLAIDLLEKLLVFDPSKRITVQEALEHPYLEAYHDPSHEPITSPIPVEEFEFDMDKKQLDVEDLKQQIYKQIMATNQI ED7AABCDD4F26A61 a7tjh8_vanpo RING-type domain-containing protein Kpol_1061p54 protein protein vanpo Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) MYSNHDEILNQLTNIGGGYQYSPVKTPVAENSSEFENSKKSTPSPFSRNKSWTSKLAKFQLSNSRKKKTPTQSPASISSQELNYSEKTNQVPSITPIITPSSQYPTRISSLPRPNSMVFHQNSRKVSSNSAHSNDSNKSQTKKNVPKQQMPFQYTKLTNLAKKSFLNESCTLCEESISNRTNGERVIQLECGHVTHQECLTISFGNSNNYDKTDIYSLFPVCAKCKVERFKSNRCIPNSDEIKDRLVSDFLIGKNSITAQSLNQLDPEMINELMSPLPSPIQEVERKSMYQSVGSPVSSFESHRSVSPINRGGMSLMNPPSGPRNRSNFGKSYSRIGSTIVASSSIHSSADDHESIFSEVASSNFDPGNDEEDKIPLPLIRSYFVEMLVNNFEGEITKWTCDDNFGLLRLVDKLSVSENGSDYTNCQCFLFEKSMVIAEINEENNAKPNNDSIFLGTSLINLKIYICTTGIKVETRNSSVLKVTINNGQNSKPSSLYLTENIDSISSKVIQKWISGLLDSELLFNESNFTSTLSLPTVIQNLGDEEEKSTFVGLISPNKIVEVARLENNRESTIIRRGITVFSGIENGTNMDTLQTMMTSVSSILSLKRERPEGIVIILQLDFRKLKDDSYIIIYNSLQALVTKYPNLIYCTVDADGFVVQYGQASKDILNLQSIYKMNKPNAGIKFSPTWLKNTIYPLGITSSLGIAILSNGSMEEARSCLLMDYKIFASPGRRHANELKIKVGYLNSDYSDKITELVEIGTWAFMLEALCYSFSLSFEDDDDDEDEDDAGDDRDYYDDYSSINSDEKSITTLLIHTPLDGTFPTPVFTEDDRDNNSIVNSLQIDYT C25ECDD86C586D72 q6bnp1_debha Mitogen-activated protein kinase DEHA2E20086g protein protein debha Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) MSQLKPRRIIFNISQNFQVIQVVGEGAYGVVCLAIHKPTGIKVAIKKLEPFEKPLFCLRALREIKLLTYFKKHENIISIFDVQKPLNFENFNEIYLIQEYMPSDLHKTIATQNLTDDHIQYFIYQILRGLKLIHSANVIHRDLKPSNILVNENCDLKICDFGLARLDILKEGYDKRLAINSGISMLTEYVATRWYRAPEIMLTSSQYSTAIDMWSVGCILAELFTCTPLFPGNDYRHQLILIFQLLGTPTDADLTCIKSQRAKNYIKTLPYCSPLSLDQVFNRHPNRAKRFGGQPINPLGLDLLKKLLVFDPKERLTVEEALEHPYVSTYHDPEDEPTIMPIPHEDFEFDKSKDKLSILELKRQLYNDIIKCNR 03A0BABA65FE8227 q5a281_canal Mitogen-activated protein kinase orf19.460 CEK2 CaO19.460 CaO19.8091 protein protein canal Candida albicans (strain SC5314 / ATCC MYA-2876) Yeast MKKSTGPTQTRQVVFNISQNFKVLKILGEGAYGIVALAVHLPTETKVAIKKIEPFERPLFCLRTLREIKLLTKFKNHDNIVRLYDVQKPMNYDSFNEVYLIQEYMPSDLHNIIHTHLLSDQHVQYFIYQILKGLKMIHSARVIHRDLKPSNILVNEKCDLKICDFGLARLDTKHYNFDEAPRISMLTEYVATRWYRAPEIMLSASNYSTAIDLWSVGCILAELLTYRALFPGSDYINQLKLIFEVLGTPTDEDLQIIKSERAQKFIRSLPTKVKIDLSEFINNHPYRNIKHRGRDQVNPLAIDLLEKLLVFDPAKRITVQEALEHPYLNSYHEQLDEPVTSPIPIEEFDFDIDKKNLDTNDLKKQIFEIVMS The sequence has been withdrawn from uniprot. 53B865C200EEECB2 fus3_yeast Mitogen-activated protein kinase FUS3 FUS3 DAC2 YBL016W YBL0303 YBL03.21 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPKRIVYNISSDFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKIEPFDKPLFALRTLREIKILKHFKHENIITIFNIQRPDSFENFNEVYIIQELMQTDLHRVISTQMLSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDESAADNSEPTGQQSGMTEYVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGTPHSDNDLRCIESPRAREYIKSLPMYPAAPLEKMFPRVNPKGIDLLQRMLVFDPAKRITAKEALEHPYLQTYHDPNDEPEGEPIPPSFFEFDHYKEALTTKDLKKLIWNEIFS 5117980D20A1E7E2 5117980D20A1E7E2 erk1_canal Extracellular signal-regulated kinase 1 CEK1 ERK1 MAP kinase 1 CaO19.10404 CaO19.2886 CAALFM_C406480CA protein protein canal Candida albicans (strain SC5314 / ATCC MYA-2876) Yeast MNIDQHHQLQQQHQQQMLQQQAQAQAQAQAQAQQQQQQQQQAAAAAAAANAAATTSSSPRQVSFNVSDHYQILEIVGEGAYGIVCSAIHKPSQQKVAIKKIEPFERSMLCLRTLRELKLLKHFNHENIISILAIQRPINYESFNEIYLIQELMETDLHRVIRTQNLSDDHIQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNSNCDLKICDFGLARSIASQEDNYGFMTEYVATRWYRAPEIMLTFQEYTTAIDVWSVGCILAEMLSGRPLFPGRDYHNQLWLIMEVLGTPNMEDYYNIKSKRAREYIRSLPFCKKIPFSELFANTNNNTSTSTSNTGGRTNINPLALDLLEKLLIFNPAKRITVEDALKHPYLQLYHDPNDEPISDKIPEDFFDFDKMKDQLTIEDLKKLLYEEIMKPL EC070EC9E6501B52 q6fpf2_canga Mitogen-activated protein kinase CAGL0J04290g protein protein canga Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) Yeast Torulopsis glabrata MGKKIVFNISSDFQLKSLLGEGAYGVVCSAVHKPTGEIVAIKKIVPFDKPLFALRTLREIKILRRFQHENIISIFDIQKPESFEKFNEVYIIQELMQTDLHRVIATQTLTDDHIQYFIYQTLRAIKTLHGSNVIHRDLKPSNILINSNCDLKVCDFGLARIIDSGENGDNEVDKIGMTEYVATRWYRAPEVMLTNAKYSRAMDIWSCGCILGELFLKRPLFPGKDYRHQLLLIFGLIGTPDSSDKSMECIESRRARQYIASLQKYPPVRPLQKAFPGVNPVGVDLLSRMLVFDPRERISADDALAHPYLSTYHVPEDEPAGEPIPPDFFQFDQYKEVLTTKDLKKLLWNEIFHEQAT EF65134683EC8CCB q1k6i1_neucr NCU02393 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MSSAQRGGARKISFNVSEQYDIQDVVGEGAYGVVCSAVHKPSGQKVAIKKITPFDHSMFCLRTLREMKLLRYFNHENIISILDIQKPRSYETFNEVYLIQELMETDMHRVIRTQELSDDHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASQEDNSGFMTEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDCMYHHQLTLILDVLGTPTMEDYYGIKSRRAREYIRSLPFKKKVPFRTLFPNTSELALDLLEKLLAFNPVKRITVEEALKHPYLEPYHDPDDEPTAPPIPEEFFDFDKHKDNLSKEQLKQLIYQEIMR The sequence has been withdrawn from uniprot. 03B0CA646DE41F8B c8v7d1_emeni Mitogen-activated protein kinase mpkB ANIA_03719 protein protein emeni Emericella nidulans Aspergillus nidulans MVQQMPPQGGSRKISFNVSDQYEIQDVIGEGAYGVVCSAIHKPSGQKVAIKKITPFDHSMFCLRTLREMKLLRYFNHENIISILDIQRPRNYESFNEVYLIQELMETDMHRVIRTQDLSDDHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASTDDNSGFMTEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILDVLGTPTMEDYYGIKSRRAREYIRSLPFKKKIPFKALFPKSNDLALDLLEKLLAFNPTKRITVEEALRHPYLEPYHDPDDEPTAPPIPEGFFDFDKNKDALSKEQLKILIYEEIMR C68A6238A0956688 kss1_yeast Mitogen-activated protein kinase KSS1 KSS1 Kinase suppressor of SST2 YGR040W protein protein yeast Saccharomyces cerevisiae Baker's yeast MARTITFDIPSQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQPFSKKLFVTRTIREIKLLRYFHEHENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIKSKRAKEYIANLPMRPPLPWETVWSKTDLNPDMIDLLDKMLQFNPDKRISAAEALRHPYLAMYHDPSDEPEYPPLNLDDEFWKLDNKIMRPEEEEEVPIEMLKDMLYDELMKTME 5FA42161B5FD51B5 5FA42161B5FD51B5 ste5-cek1 2 12 unspecified role unspecified role bait bait scaffold_ste5_fus5-binding sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 18 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Suppl. Fig. S4a ste5-mpkb 2 MpkB 21 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) 12 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined scaffold_ste5_fus5-binding sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Suppl. Fig. S4a ste5-q1k6i1 2 MpkB 20 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) 12 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined scaffold_ste5_fus5-binding sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Suppl. Fig. S4a fus3-ste5-1 1 8 enzyme enzyme unspecified role unspecified role region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P06784:p.[Ser359Glu;Thr363Glu] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain T E Wed May 02 18:58:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser359glu,thr363glu' Tue Jun 30 18:49:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser359Glu;Thr363Glu]' Phosphomimetic mutations in the activation loop of Ste7 result in constitutively active enzyme. The identity of the mutations was taken from PMID:19303851. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 17 enzyme target enzyme target substrate substrate unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) 12 stimulator stimulator unspecified role unspecified role ste5_fus3-bd sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation Fig. 2a, Fig. 3a, Suppl. Fig. S2a, Suppl. Fig. S2b, Suppl. Fig. S4d fus3-q74zu4 1 17 enzyme target enzyme target substrate substrate unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) 9 stimulator stimulator unspecified role unspecified role ste5_fus3-bd sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 8 enzyme enzyme unspecified role unspecified role region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P06784:p.[Ser359Glu;Thr363Glu] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain T E Wed May 02 19:48:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser359glu,thr363glu' Tue Jun 30 18:38:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser359Glu;Thr363Glu]' Phosphomimetic mutations in the activation loop of Ste7 result in constitutively active enzyme. The identity of the mutations was taken from PMID:19303851. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation Fig. 2a, Suppl. Fig. S2a, Suppl. Fig. S2b a7tjh8-fus3 1 14 stimulator stimulator unspecified role unspecified role ste5_fus3-bd sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 8 enzyme enzyme unspecified role unspecified role region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P06784:p.[Ser359Glu;Thr363Glu] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain T E Wed May 02 16:30:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser359glu,thr363glu' Tue Jun 30 18:51:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser359Glu;Thr363Glu]' Phosphomimetic mutations in the activation loop of Ste7 result in constitutively active enzyme. The identity of the mutations was taken from PMID:19303851. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 17 enzyme target enzyme target substrate substrate unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation Fig. 2a, Suppl. Fig. S2a, Suppl. Fig. S2b fus3-q6fl43 1 8 enzyme enzyme unspecified role unspecified role region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P06784:p.[Ser359Glu;Thr363Glu] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain T E Wed May 02 18:16:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser359glu,thr363glu' Tue Jun 30 17:34:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser359Glu;Thr363Glu]' Phosphomimetic mutations in the activation loop of Ste7 result in constitutively active enzyme. The identity of the mutations was taken from PMID:19303851. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 5 stimulator stimulator unspecified role unspecified role ste5_fus3-bd sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 17 enzyme target enzyme target substrate substrate unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation Fig. 2a, Suppl. Fig. S2a, Suppl. Fig. S2b c5dsp8-fus3 1 17 enzyme target enzyme target substrate substrate unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) 8 enzyme enzyme unspecified role unspecified role region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P06784:p.[Ser359Glu;Thr363Glu] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain T E Wed May 02 15:10:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser359glu,thr363glu' Tue Jun 30 16:48:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser359Glu;Thr363Glu]' Phosphomimetic mutations in the activation loop of Ste7 result in constitutively active enzyme. The identity of the mutations was taken from PMID:19303851. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 3 stimulator stimulator unspecified role unspecified role ste5_fus3-bd sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation Fig. 2a, Suppl. Fig. S2a, Suppl. Fig. S2b fus3-ste5-2 1 17 putative self putative self unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) 12 stimulator stimulator unspecified role unspecified role scaffold_ste5_fus5-binding sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation Fig. 2b, Fig. 3b, Suppl. Fig. S3a, Suppl. Fig. S3b, Suppl. Fig. S3d, Suppl. Fig. S5b a7tjh8-fus3-1 1 14 stimulator stimulator unspecified role unspecified role region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain A7TJH8:p.[Lys254Ala;Asn255Ala;Leu262Ala;Leu265Ala;Pro267Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain P A Fri Jul 22 10:58:03 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'asn255ala,leu262ala,lys254ala,leu265ala,pro267ala' Wed May 02 14:26:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys254ala,asn255ala,leu262ala,leu265ala,pro267ala' Tue Jun 30 15:39:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys254Ala;Asn255Ala;Leu262Ala;Leu265Ala;Pro267Ala]' ecobb Escherichia coli (strain B / BL21) 17 putative self putative self unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation Fig. 2b, Fig. 5b, Suppl. Fig. S3a, Suppl. Fig. S3b, Suppl. Fig. S3d, Suppl. Fig. S5a, Suppl. Fig. S5b fus3-1 1 17 putative self putative self unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation true Fig. 2b, Fig. 3b, Suppl. Fig. S3a q6fpf2-ste5 1 19 enzyme target enzyme target substrate substrate unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) 8 enzyme enzyme unspecified role unspecified role region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P06784:p.[Ser359Glu;Thr363Glu] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain T E Wed May 02 17:23:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser359glu,thr363glu' Tue Jun 30 17:25:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser359Glu;Thr363Glu]' Phosphomimetic mutations in the activation loop of Ste7 result in constitutively active enzyme. The identity of the mutations was taken from PMID:19303851. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 12 stimulator stimulator unspecified role unspecified role ste5_fus3-bd sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation Fig. 3a kss1-ste7-1 1 22 enzyme target enzyme target substrate substrate unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) 8 enzyme enzyme unspecified role unspecified role region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P06784:p.[Ser359Glu;Thr363Glu] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain T E Wed May 02 16:53:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser359glu,thr363glu' Tue Jun 30 18:51:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser359Glu;Thr363Glu]' Phosphomimetic mutations in the activation loop of Ste7 result in constitutively active enzyme. The identity of the mutations was taken from PMID:19303851. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation Fig. 3a q6cy79-ste7 1 8 enzyme enzyme unspecified role unspecified role region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P06784:p.[Ser359Glu;Thr363Glu] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain T E Wed May 02 19:27:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser359glu,thr363glu' Tue Jun 30 18:18:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser359Glu;Thr363Glu]' Phosphomimetic mutations in the activation loop of Ste7 result in constitutively active enzyme. The identity of the mutations was taken from PMID:19303851. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 10 enzyme target enzyme target substrate substrate unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation Fig. 3a q75cv7-ste7 1 7 enzyme target enzyme target substrate substrate unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) 8 enzyme enzyme unspecified role unspecified role region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P06784:p.[Ser359Glu;Thr363Glu] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain T E Wed May 02 17:09:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser359glu,thr363glu' Tue Jun 30 17:49:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser359Glu;Thr363Glu]' Phosphomimetic mutations in the activation loop of Ste7 result in constitutively active enzyme. The identity of the mutations was taken from PMID:19303851. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation Fig. 3a kss1-2 1 22 putative self putative self unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation true Fig. 3b q6cy79-1 1 10 putative self putative self unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation true Fig. 3b q75cv7-1 1 7 putative self putative self unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation true Fig. 3b cek1 1 18 putative self putative self unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation true Fig. 3b mpkb 1 21 putative self putative self unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation true Fig. 3b q1k6i1 1 20 putative self putative self unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation true Fig. 3b q6bnp1 1 15 putative self putative self unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation true Fig. 3b q6fpf2-ste5-1 1 12 stimulator stimulator unspecified role unspecified role scaffold_ste5_fus5-binding sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 19 putative self putative self unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation Fig. 3b c5m3m0-ste5 1 13 putative self putative self unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) 12 stimulator stimulator unspecified role unspecified role scaffold_ste5_fus5-binding sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation Fig. 3b cek2-ste5 1 12 stimulator stimulator unspecified role unspecified role scaffold_ste5_fus5-binding sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 16 putative self putative self unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation Fig. 3b a5e0p6-ste5 1 6 putative self putative self unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) 12 stimulator stimulator unspecified role unspecified role scaffold_ste5_fus5-binding sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation Fig. 3b spk1-ste5 1 12 stimulator stimulator unspecified role unspecified role scaffold_ste5_fus5-binding sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 11 putative self putative self unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation Fig. 3b q6cnr3-ste5 1 12 stimulator stimulator unspecified role unspecified role scaffold_ste5_fus5-binding sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 4 putative self putative self unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation Fig. 3b q6cnr3-ste5-1 1 8 enzyme enzyme unspecified role unspecified role region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P06784:p.[Ser359Glu;Thr363Glu] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain T E Wed May 02 16:56:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser359glu,thr363glu' Tue Jun 30 19:42:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser359Glu;Thr363Glu]' Phosphomimetic mutations in the activation loop of Ste7 result in constitutively active enzyme. The identity of the mutations was taken from PMID:19303851. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 12 stimulator stimulator unspecified role unspecified role ste5_fus3-bd sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 4 enzyme target enzyme target substrate substrate unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation Fig. 3a cek2-ste5-1 1 8 enzyme enzyme unspecified role unspecified role region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P06784:p.[Ser359Glu;Thr363Glu] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain T E Wed May 02 16:49:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser359glu,thr363glu' Tue Jun 30 18:40:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser359Glu;Thr363Glu]' spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 12 stimulator stimulator unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) 16 enzyme target enzyme target substrate substrate unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation Fig. 3a, Suppl. Fig. S4e mpkb-ste5 1 12 stimulator stimulator unspecified role unspecified role ste5_fus3-bd sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 8 enzyme enzyme unspecified role unspecified role region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P06784:p.[Ser359Glu;Thr363Glu] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain T E Wed May 02 15:14:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser359glu,thr363glu' Tue Jun 30 20:05:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser359Glu;Thr363Glu]' spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 21 enzyme target enzyme target substrate substrate unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation Fig. 3a mpkb-ste5-1 1 8 enzyme enzyme unspecified role unspecified role region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P06784:p.[Ser359Glu;Thr363Glu] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain T E Wed May 02 16:58:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser359glu,thr363glu' Tue Jun 30 18:01:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser359Glu;Thr363Glu]' spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 12 stimulator stimulator unspecified role unspecified role ste5_fus3-bd sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 20 enzyme target enzyme target substrate substrate unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation Fig. 3a q6bnp1-ste5 1 12 stimulator stimulator unspecified role unspecified role ste5_fus3-bd sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 8 enzyme enzyme unspecified role unspecified role P06784:p.[Ser359Glu;Thr363Glu] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain T E Wed May 02 14:51:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser359glu,thr363glu' Tue Jun 30 17:26:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser359Glu;Thr363Glu]' region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 15 enzyme target enzyme target substrate substrate unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation Fig. 3a cek1-ste5 1 18 enzyme target enzyme target substrate substrate unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) 12 stimulator stimulator unspecified role unspecified role ste5_fus3-bd sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 8 enzyme enzyme unspecified role unspecified role region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P06784:p.[Ser359Glu;Thr363Glu] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain T E Wed May 02 16:31:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser359glu,thr363glu' Tue Jun 30 18:19:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser359Glu;Thr363Glu]' spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation Fig. 3a c5m3m0-ste7 1 8 enzyme enzyme unspecified role unspecified role P06784:p.[Ser359Glu;Thr363Glu] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain T E Wed May 02 14:29:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser359glu,thr363glu' Tue Jun 30 16:20:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser359Glu;Thr363Glu]' region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 13 enzyme target enzyme target substrate substrate unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation Fig. 3a a5e0p6-ste7 1 6 enzyme target enzyme target substrate substrate unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) 8 enzyme enzyme unspecified role unspecified role P06784:p.[Ser359Glu;Thr363Glu] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain T E Wed May 02 18:04:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser359glu,thr363glu' Tue Jun 30 17:19:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser359Glu;Thr363Glu]' region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation Fig. 3a spk1-ste7 1 11 enzyme target enzyme target substrate substrate unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) 8 enzyme enzyme unspecified role unspecified role region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P06784:p.[Ser359Glu;Thr363Glu] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain T E Wed May 02 19:40:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser359glu,thr363glu' Tue Jun 30 18:45:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser359Glu;Thr363Glu]' spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation Fig. 3a