IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The Parkinson's disease-linked proteins Fbxo7 and Parkin interact to mediate mitophagy. The Parkinson's disease-linked proteins Fbxo7 and Parkin interact to mediate mitophagy. Nat. Neurosci. (1097-6256) 2013 imex curation Burchell V.S., Nelson D.E., Sanchez-Martinez A., Delgado-Camprubi M., Ivatt R.M., Pogson J.H., Randle S.J., Wray S., Lewis P.A., Houlden H., Abramov A.Y., Hardy J., Wood N.W., Whitworth A.J., Laman H., Plun-Favreau H. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. The authors have confirmed that Flag-Parkin and Pink1-myc/HA are of Human origin. The authors have stated that in Figure 2B, the cell line used was SH-SY5Y, and also that in Supplementary Figure 4C - the cell line used has been confirmed as U2OS. a.whitworth@sheffield.ac.uk,hl316@cam.ac.uk,h.plun-favreau@ucl.ac.uk 14-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Burchell V.S., Nelson D.E., Sanchez-Martinez A., Delgado-Camprubi M., Ivatt R.M., Pogson J.H., Randle S.J., Wray S., Lewis P.A., Houlden H., Abramov A.Y., Hardy J., Wood N.W., Whitworth A.J., Laman H., Plun-Favreau H. Parkinsons - Interactions investigated in the context of Parkinsons disease The authors have confirmed that Flag-Parkin and Pink1-myc/HA are of Human origin. The authors have stated that in Figure 2B, the cell line used was SH-SY5Y, and also that in Supplementary Figure 4C - the cell line used has been confirmed as U2OS. a.whitworth@sheffield.ac.uk,hl316@cam.ac.uk,h.plun-favreau@ucl.ac.uk Accepted 2014-APR-01 by ORCHARD Nat. Neurosci. (1097-6256) 2013 Only protein-protein interactions imex curation The Parkinson's disease-linked proteins Fbxo7 and Parkin interact to mediate mitophagy. The Parkinson's disease-linked proteins Fbxo7 and Parkin interact to mediate mitophagy. Nat. Neurosci. (1097-6256) 2013 imex curation Burchell V.S., Nelson D.E., Sanchez-Martinez A., Delgado-Camprubi M., Ivatt R.M., Pogson J.H., Randle S.J., Wray S., Lewis P.A., Houlden H., Abramov A.Y., Hardy J., Wood N.W., Whitworth A.J., Laman H., Plun-Favreau H. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. The authors have confirmed that Flag-Parkin and Pink1-myc/HA are of Human origin. The authors have stated that in Figure 2B, the cell line used was SH-SY5Y, and also that in Supplementary Figure 4C - the cell line used has been confirmed as U2OS. a.whitworth@sheffield.ac.uk,hl316@cam.ac.uk,h.plun-favreau@ucl.ac.uk 14-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Burchell V.S., Nelson D.E., Sanchez-Martinez A., Delgado-Camprubi M., Ivatt R.M., Pogson J.H., Randle S.J., Wray S., Lewis P.A., Houlden H., Abramov A.Y., Hardy J., Wood N.W., Whitworth A.J., Laman H., Plun-Favreau H. Parkinsons - Interactions investigated in the context of Parkinsons disease The authors have confirmed that Figure 2B was carried out in SH-SY5Y cells (as stated in the text) rather than HEK293T cells (as stated in the figure legend). The authors have confirmed that Flag-Parkin and Pink1-myc/HA are of Human origin. The authors have stated that in Figure 2B, the cell line used was SH-SY5Y, and also that in Supplementary Figure 4C - the cell line used has been confirmed as U2OS. a.whitworth@sheffield.ac.uk,hl316@cam.ac.uk,h.plun-favreau@ucl.ac.uk Accepted 2014-APR-01 by ORCHARD Nat. Neurosci. (1097-6256) 2013 Only protein-protein interactions imex curation The Parkinson's disease-linked proteins Fbxo7 and Parkin interact to mediate mitophagy. The Parkinson's disease-linked proteins Fbxo7 and Parkin interact to mediate mitophagy. Nat. Neurosci. (1097-6256) 2013 imex curation Burchell V.S., Nelson D.E., Sanchez-Martinez A., Delgado-Camprubi M., Ivatt R.M., Pogson J.H., Randle S.J., Wray S., Lewis P.A., Houlden H., Abramov A.Y., Hardy J., Wood N.W., Whitworth A.J., Laman H., Plun-Favreau H. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. The authors have confirmed that Flag-Parkin and Pink1-myc/HA are of Human origin. The authors have stated that in Figure 2B, the cell line used was SH-SY5Y, and also that in Supplementary Figure 4C - the cell line used has been confirmed as U2OS. a.whitworth@sheffield.ac.uk,hl316@cam.ac.uk,h.plun-favreau@ucl.ac.uk 14-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Burchell V.S., Nelson D.E., Sanchez-Martinez A., Delgado-Camprubi M., Ivatt R.M., Pogson J.H., Randle S.J., Wray S., Lewis P.A., Houlden H., Abramov A.Y., Hardy J., Wood N.W., Whitworth A.J., Laman H., Plun-Favreau H. Parkinsons - Interactions investigated in the context of Parkinsons disease The authors have confirmed that in Supplementary Figure 4C the cell line used is U2OS. The authors have confirmed that Flag-Parkin and Pink1-myc/HA are of Human origin. The authors have stated that in Figure 2B, the cell line used was SH-SY5Y, and also that in Supplementary Figure 4C - the cell line used has been confirmed as U2OS. a.whitworth@sheffield.ac.uk,hl316@cam.ac.uk,h.plun-favreau@ucl.ac.uk Accepted 2014-APR-01 by ORCHARD Nat. Neurosci. (1097-6256) 2013 Only protein-protein interactions imex curation The Parkinson's disease-linked proteins Fbxo7 and Parkin interact to mediate mitophagy. The Parkinson's disease-linked proteins Fbxo7 and Parkin interact to mediate mitophagy. Nat. Neurosci. (1097-6256) 2013 imex curation Burchell V.S., Nelson D.E., Sanchez-Martinez A., Delgado-Camprubi M., Ivatt R.M., Pogson J.H., Randle S.J., Wray S., Lewis P.A., Houlden H., Abramov A.Y., Hardy J., Wood N.W., Whitworth A.J., Laman H., Plun-Favreau H. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. The authors have confirmed that Flag-Parkin and Pink1-myc/HA are of Human origin. The authors have stated that in Figure 2B, the cell line used was SH-SY5Y, and also that in Supplementary Figure 4C - the cell line used has been confirmed as U2OS. a.whitworth@sheffield.ac.uk,hl316@cam.ac.uk,h.plun-favreau@ucl.ac.uk 14-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Burchell V.S., Nelson D.E., Sanchez-Martinez A., Delgado-Camprubi M., Ivatt R.M., Pogson J.H., Randle S.J., Wray S., Lewis P.A., Houlden H., Abramov A.Y., Hardy J., Wood N.W., Whitworth A.J., Laman H., Plun-Favreau H. Parkinsons - Interactions investigated in the context of Parkinsons disease The authors have confirmed that Flag-Parkin and Pink1-myc/HA are of Human origin. The authors have stated that in Figure 2B, the cell line used was SH-SY5Y, and also that in Supplementary Figure 4C - the cell line used has been confirmed as U2OS. a.whitworth@sheffield.ac.uk,hl316@cam.ac.uk,h.plun-favreau@ucl.ac.uk Accepted 2014-APR-01 by ORCHARD Nat. Neurosci. (1097-6256) 2013 Only protein-protein interactions imex curation The Parkinson's disease-linked proteins Fbxo7 and Parkin interact to mediate mitophagy. The Parkinson's disease-linked proteins Fbxo7 and Parkin interact to mediate mitophagy. Nat. Neurosci. (1097-6256) 2013 imex curation Burchell V.S., Nelson D.E., Sanchez-Martinez A., Delgado-Camprubi M., Ivatt R.M., Pogson J.H., Randle S.J., Wray S., Lewis P.A., Houlden H., Abramov A.Y., Hardy J., Wood N.W., Whitworth A.J., Laman H., Plun-Favreau H. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. The authors have confirmed that Flag-Parkin and Pink1-myc/HA are of Human origin. The authors have stated that in Figure 2B, the cell line used was SH-SY5Y, and also that in Supplementary Figure 4C - the cell line used has been confirmed as U2OS. a.whitworth@sheffield.ac.uk,hl316@cam.ac.uk,h.plun-favreau@ucl.ac.uk 14-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Burchell V.S., Nelson D.E., Sanchez-Martinez A., Delgado-Camprubi M., Ivatt R.M., Pogson J.H., Randle S.J., Wray S., Lewis P.A., Houlden H., Abramov A.Y., Hardy J., Wood N.W., Whitworth A.J., Laman H., Plun-Favreau H. Parkinsons - Interactions investigated in the context of Parkinsons disease The authors have confirmed that Flag-Parkin and Pink1-myc/HA are of Human origin. The authors have stated that in Figure 2B, the cell line used was SH-SY5Y, and also that in Supplementary Figure 4C - the cell line used has been confirmed as U2OS. a.whitworth@sheffield.ac.uk,hl316@cam.ac.uk,h.plun-favreau@ucl.ac.uk Accepted 2014-APR-01 by ORCHARD Nat. Neurosci. (1097-6256) 2013 Only protein-protein interactions imex curation The Parkinson's disease-linked proteins Fbxo7 and Parkin interact to mediate mitophagy. The Parkinson's disease-linked proteins Fbxo7 and Parkin interact to mediate mitophagy. Nat. Neurosci. (1097-6256) 2013 imex curation Burchell V.S., Nelson D.E., Sanchez-Martinez A., Delgado-Camprubi M., Ivatt R.M., Pogson J.H., Randle S.J., Wray S., Lewis P.A., Houlden H., Abramov A.Y., Hardy J., Wood N.W., Whitworth A.J., Laman H., Plun-Favreau H. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. The authors have confirmed that Flag-Parkin and Pink1-myc/HA are of Human origin. The authors have stated that in Figure 2B, the cell line used was SH-SY5Y, and also that in Supplementary Figure 4C - the cell line used has been confirmed as U2OS. a.whitworth@sheffield.ac.uk,hl316@cam.ac.uk,h.plun-favreau@ucl.ac.uk 14-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Burchell V.S., Nelson D.E., Sanchez-Martinez A., Delgado-Camprubi M., Ivatt R.M., Pogson J.H., Randle S.J., Wray S., Lewis P.A., Houlden H., Abramov A.Y., Hardy J., Wood N.W., Whitworth A.J., Laman H., Plun-Favreau H. Parkinsons - Interactions investigated in the context of Parkinsons disease The authors have confirmed that Flag-Parkin and Pink1-myc/HA are of Human origin. The authors have stated that in Figure 2B, the cell line used was SH-SY5Y, and also that in Supplementary Figure 4C - the cell line used has been confirmed as U2OS. a.whitworth@sheffield.ac.uk,hl316@cam.ac.uk,h.plun-favreau@ucl.ac.uk Accepted 2014-APR-01 by ORCHARD Nat. Neurosci. (1097-6256) 2013 Only protein-protein interactions imex curation The Parkinson's disease-linked proteins Fbxo7 and Parkin interact to mediate mitophagy. The Parkinson's disease-linked proteins Fbxo7 and Parkin interact to mediate mitophagy. Nat. Neurosci. (1097-6256) 2013 imex curation Burchell V.S., Nelson D.E., Sanchez-Martinez A., Delgado-Camprubi M., Ivatt R.M., Pogson J.H., Randle S.J., Wray S., Lewis P.A., Houlden H., Abramov A.Y., Hardy J., Wood N.W., Whitworth A.J., Laman H., Plun-Favreau H. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. The authors have confirmed that Flag-Parkin and Pink1-myc/HA are of Human origin. The authors have stated that in Figure 2B, the cell line used was SH-SY5Y, and also that in Supplementary Figure 4C - the cell line used has been confirmed as U2OS. a.whitworth@sheffield.ac.uk,hl316@cam.ac.uk,h.plun-favreau@ucl.ac.uk 14-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Burchell V.S., Nelson D.E., Sanchez-Martinez A., Delgado-Camprubi M., Ivatt R.M., Pogson J.H., Randle S.J., Wray S., Lewis P.A., Houlden H., Abramov A.Y., Hardy J., Wood N.W., Whitworth A.J., Laman H., Plun-Favreau H. Parkinsons - Interactions investigated in the context of Parkinsons disease The authors have confirmed that Flag-Parkin and Pink1-myc/HA are of Human origin. The authors have stated that in Figure 2B, the cell line used was SH-SY5Y, and also that in Supplementary Figure 4C - the cell line used has been confirmed as U2OS. a.whitworth@sheffield.ac.uk,hl316@cam.ac.uk,h.plun-favreau@ucl.ac.uk Accepted 2014-APR-01 by ORCHARD Nat. Neurosci. (1097-6256) 2013 Only protein-protein interactions imex curation prkn_human E3 ubiquitin-protein ligase parkin PRKN PARK2 Parkin RBR E3 ubiquitin-protein ligase Parkinson juvenile disease protein 2 protein protein human Homo sapiens Human MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV DIP protein O60260 original sequence version: 99 DIP protein O60260-1 original sequence version: 145 DIP protein O60260-1 original sequence version: 158 DIP protein O60260 original sequence version: 157 9A8BB802A3FC84C3 q9y3i1-1 F-box only protein 7 FBXO7 FBX7 protein protein human Homo sapiens Human MRLRVRLLKRTWPLEVPETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPLTGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTSMQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM C4E5E70A0747287A q9y3i1-2 F-box only protein 7 FBXO7 FBX7 protein protein human Homo sapiens Human MARPPGGSGPLLDSEHSSLQNNEQPSLATSSNQTSMQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM 263A319CE0096FFB fbx7_human F-box only protein 7 FBXO7 FBX7 protein protein human Homo sapiens Human MRLRVRLLKRTWPLEVPETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPLTGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTSMQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM DIP protein Q9Y3I1 original sequence version: 87 C4E5E70A0747287A pink1_human Serine/threonine-protein kinase PINK1, mitochondrial PINK1 BRPK PTEN-induced putative kinase protein 1 protein protein human Homo sapiens Human MAVRQALGRGLQLGRALLLRFTGKPGRAYGLGRPGPAAGCVRGERPGWAAGPGAEPRRVGLGLPNRLRFFRQSVAGLAARLQRQFVVRAWGCAGPCGRAVFLAFGLGLGLIEEKQAESRRAVSACQEIQAIFTQKSKPGPDPLDTRRLQGFRLEEYLIGQSIGKGCSAAVYEATMPTLPQNLEVTKSTGLLPGRGPGTSAPGEGQERAPGAPAFPLAIKMMWNISAGSSSEAILNTMSQELVPASRVALAGEYGAVTYRKSKRGPKQLAPHPNIIRVLRAFTSSVPLLPGALVDYPDVLPSRLHPEGLGHGRTLFLVMKNYPCTLRQYLCVNTPSPRLAAMMLLQLLEGVDHLVQQGIAHRDLKSDNILVELDPDGCPWLVIADFGCCLADESIGLQLPFSSWYVDRGGNGCLMAPEVSTARPGPRAVIDYSKADAWAVGAIAYEIFGLVNPFYGQGKAHLESRSYQEAQLPALPESVPPDVRQLVRALLQREASKRPSARVAANVLHLSLWGEHILALKNLKLDKMVGWLLQQSAATLLANRLTEKCCVETKMKMLFLANLECETLCQAALLLCSWRAAL 721FE01F63263A64 park2-fbxo7 6 11 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9Y3I1:p.Thr22Met mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T M Wed May 02 16:04:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr22met' Tue Jun 30 19:59:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr22Met' 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1B/G park2-fbxo7-1 7 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey physical association physical association 1C/H. park2-fbxo7-2 6 9 unspecified role unspecified role prey prey n_terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ubl_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1D park2-fbxo7-3 3 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1E fbxo7-park2 5 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 11 unspecified role unspecified role bait bait ubl_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 1F, 4E fbxo7-park2-1 3 12 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 4A fbxo7-pink1 6 12 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait enlarged_ubl_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 4B, 4C fbxo7-park2-3 4 12 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 11 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range enlarged_ubl_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 4D fbxo7-park2-4 5 12 unspecified role unspecified role prey prey cytoplasmic_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 11 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 4Ei fbxo7-park2-5 5 12 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cytoplasmic_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 11 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro association association 4Eii The first 103 amino acids of PINK1 are not necessary for this interaction. Neither Parkin nor PINK1 had any significant effect on the interaction of Fbxo7 with the other protein. pink1-fbxo7 5 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 12 unspecified role unspecified role bait bait cytoplasmic_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro association association 4F Fbxo7, Parkin and PINK1 probably interact in a noncompetitive, nonsynergistic manner. pink1-fbxo7-2 5 12 unspecified role unspecified role bait bait cytoplasmic_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 4Fii Fbxo7, Parkin and PINK1 probably interact in a noncompetitive, nonsynergistic manner. park2-fbxo7-4 5 11 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 12 unspecified role unspecified role prey prey region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cytoplasmic_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 8 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) association association 4F-2 Fbxo7, Parkin and PINK1 probably interact in a noncompetitive, nonsynergistic manner. park2-fbxo7-5 5 11 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 4F-2i Fbxo7, Parkin and PINK1 probably interact in a noncompetitive, nonsynergistic manner. park2-fbxo7-6 5 8 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey cytoplasmic_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 4F-2ii Fbxo7, Parkin and PINK1 probably interact in a noncompetitive, nonsynergistic manner. fbxo7-park2-6 1 11 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp 1A fbxo7-park2-7 6 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait n_terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supp 1B park2-fbxo7-7 3 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9Y3I1:p.Thr22Met mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T M Wed May 02 20:01:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr22met' Tue Jun 30 18:06:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr22Met' physical association physical association Supp 1C/D Both the R378G and R498X mutations caused no significant change in Parkin binding. pink1-fbxo7-3 6 12 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey n_terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supp 4A fbxo7-pink1-1 3 11 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp 4B This interaction was unaffected by Fbxo7 pathogenic mutations - T22M, R378G and R498X. fbxo7-pink1-2 3 12 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supp 4C PINK1 retained partial binding to Fbxo7 isoform 2. fbxo7-pink1-3 3 10 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp 4C PINK1 retained partial binding to Fbxo7 isoform 2. park2-fbxo7-8 2 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey physical association physical association 2B. CCCP- carbonyl cyanide 3-chlorophenylhydrazone, an uncoupler of oxidative phosphorylation/electron transport in mitochondria.