IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A prolyl-isomerase mediates dopamine-dependent plasticity and cocaine motor sensitization. A prolyl-isomerase mediates dopamine-dependent plasticity and cocaine motor sensitization. Cell (0092-8674) 2013 imex curation Park J.M., Hu J.H., Milshteyn A., Zhang P.W., Moore C.G., Park S., Datko M.C., Domingo R.D., Reyes C.M., Wang X.J., Etzkorn F.A., Xiao B., Szumlinski K.K., Kern D., Linden D.J., Worley P.F. Origin of constructs obtained from the author. Mutation numbering for Murine mGluR5 taken from current UniProt entry Q3UVX5. pworley@jhmi.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Park J.M., Hu J.H., Milshteyn A., Zhang P.W., Moore C.G., Park S., Datko M.C., Domingo R.D., Reyes C.M., Wang X.J., Etzkorn F.A., Xiao B., Szumlinski K.K., Kern D., Linden D.J., Worley P.F. Origin of constructs obtained from the author. Mutation numbering for Murine mGluR5 taken from current UniProt entry Q3UVX5. pworley@jhmi.edu Accepted 2013-DEC-23 by MGT Cell (0092-8674) 2013 Only protein-protein interactions imex curation A prolyl-isomerase mediates dopamine-dependent plasticity and cocaine motor sensitization. A prolyl-isomerase mediates dopamine-dependent plasticity and cocaine motor sensitization. Cell (0092-8674) 2013 imex curation Park J.M., Hu J.H., Milshteyn A., Zhang P.W., Moore C.G., Park S., Datko M.C., Domingo R.D., Reyes C.M., Wang X.J., Etzkorn F.A., Xiao B., Szumlinski K.K., Kern D., Linden D.J., Worley P.F. Origin of constructs obtained from the author. Mutation numbering for Murine mGluR5 taken from current UniProt entry Q3UVX5. pworley@jhmi.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Park J.M., Hu J.H., Milshteyn A., Zhang P.W., Moore C.G., Park S., Datko M.C., Domingo R.D., Reyes C.M., Wang X.J., Etzkorn F.A., Xiao B., Szumlinski K.K., Kern D., Linden D.J., Worley P.F. Origin of constructs obtained from the author. Mutation numbering for Murine mGluR5 taken from current UniProt entry Q3UVX5. pworley@jhmi.edu Accepted 2013-DEC-23 by MGT Cell (0092-8674) 2013 Only protein-protein interactions imex curation A prolyl-isomerase mediates dopamine-dependent plasticity and cocaine motor sensitization. A prolyl-isomerase mediates dopamine-dependent plasticity and cocaine motor sensitization. Cell (0092-8674) 2013 imex curation Park J.M., Hu J.H., Milshteyn A., Zhang P.W., Moore C.G., Park S., Datko M.C., Domingo R.D., Reyes C.M., Wang X.J., Etzkorn F.A., Xiao B., Szumlinski K.K., Kern D., Linden D.J., Worley P.F. Origin of constructs obtained from the author. Mutation numbering for Murine mGluR5 taken from current UniProt entry Q3UVX5. pworley@jhmi.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Park J.M., Hu J.H., Milshteyn A., Zhang P.W., Moore C.G., Park S., Datko M.C., Domingo R.D., Reyes C.M., Wang X.J., Etzkorn F.A., Xiao B., Szumlinski K.K., Kern D., Linden D.J., Worley P.F. Origin of constructs obtained from the author. Mutation numbering for Murine mGluR5 taken from current UniProt entry Q3UVX5. pworley@jhmi.edu Accepted 2013-DEC-23 by MGT Cell (0092-8674) 2013 Only protein-protein interactions imex curation A prolyl-isomerase mediates dopamine-dependent plasticity and cocaine motor sensitization. A prolyl-isomerase mediates dopamine-dependent plasticity and cocaine motor sensitization. Cell (0092-8674) 2013 imex curation Park J.M., Hu J.H., Milshteyn A., Zhang P.W., Moore C.G., Park S., Datko M.C., Domingo R.D., Reyes C.M., Wang X.J., Etzkorn F.A., Xiao B., Szumlinski K.K., Kern D., Linden D.J., Worley P.F. Origin of constructs obtained from the author. Mutation numbering for Murine mGluR5 taken from current UniProt entry Q3UVX5. pworley@jhmi.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-brain-striatum Mouse striatum brain_striatum Brain striatum, Neostratum. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Park J.M., Hu J.H., Milshteyn A., Zhang P.W., Moore C.G., Park S., Datko M.C., Domingo R.D., Reyes C.M., Wang X.J., Etzkorn F.A., Xiao B., Szumlinski K.K., Kern D., Linden D.J., Worley P.F. Origin of constructs obtained from the author. Mutation numbering for Murine mGluR5 taken from current UniProt entry Q3UVX5. pworley@jhmi.edu Accepted 2013-DEC-23 by MGT Cell (0092-8674) 2013 Only protein-protein interactions imex curation A prolyl-isomerase mediates dopamine-dependent plasticity and cocaine motor sensitization. A prolyl-isomerase mediates dopamine-dependent plasticity and cocaine motor sensitization. Cell (0092-8674) 2013 imex curation Park J.M., Hu J.H., Milshteyn A., Zhang P.W., Moore C.G., Park S., Datko M.C., Domingo R.D., Reyes C.M., Wang X.J., Etzkorn F.A., Xiao B., Szumlinski K.K., Kern D., Linden D.J., Worley P.F. Origin of constructs obtained from the author. Mutation numbering for Murine mGluR5 taken from current UniProt entry Q3UVX5. pworley@jhmi.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Park J.M., Hu J.H., Milshteyn A., Zhang P.W., Moore C.G., Park S., Datko M.C., Domingo R.D., Reyes C.M., Wang X.J., Etzkorn F.A., Xiao B., Szumlinski K.K., Kern D., Linden D.J., Worley P.F. 1H-15N heteronuclear exchange spectroscopy (ZZ-exchange) Origin of constructs obtained from the author. Mutation numbering for Murine mGluR5 taken from current UniProt entry Q3UVX5. pworley@jhmi.edu Accepted 2013-DEC-23 by MGT Cell (0092-8674) 2013 Only protein-protein interactions imex curation A prolyl-isomerase mediates dopamine-dependent plasticity and cocaine motor sensitization. A prolyl-isomerase mediates dopamine-dependent plasticity and cocaine motor sensitization. Cell (0092-8674) 2013 imex curation Park J.M., Hu J.H., Milshteyn A., Zhang P.W., Moore C.G., Park S., Datko M.C., Domingo R.D., Reyes C.M., Wang X.J., Etzkorn F.A., Xiao B., Szumlinski K.K., Kern D., Linden D.J., Worley P.F. Origin of constructs obtained from the author. Mutation numbering for Murine mGluR5 taken from current UniProt entry Q3UVX5. pworley@jhmi.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Park J.M., Hu J.H., Milshteyn A., Zhang P.W., Moore C.G., Park S., Datko M.C., Domingo R.D., Reyes C.M., Wang X.J., Etzkorn F.A., Xiao B., Szumlinski K.K., Kern D., Linden D.J., Worley P.F. Origin of constructs obtained from the author. Mutation numbering for Murine mGluR5 taken from current UniProt entry Q3UVX5. pworley@jhmi.edu Accepted 2013-DEC-23 by MGT Cell (0092-8674) 2013 Only protein-protein interactions imex curation pin1_mouse Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Pin1 Peptidyl-prolyl cis-trans isomerase Pin1 protein protein mouse Mus musculus Mouse MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGSTVGGSSKNGQGEPAKVRCSHLLVKHSQSRRPSSWRQEKITRSKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGPFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE DIP protein Q9QUR7 original sequence version: 81 188E95F009176B1F q9z214-1 Homer protein homolog 1 1c Vesl-1L Homer1 Homer Vesl PSD-Zip45 VASP/Ena-related gene up-regulated during seizure and LTP 1 protein protein rat Rattus norvegicus (Rat) Rat MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPAQNALPFSHSAGDRTQGLSHASSAISKHWEAELATLKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVTELECVSSQANAVHSHKTELSQTVQELEETLKVKEEEIERLKQEIDNARELQEQRDSLTQKLQEVEIRNKDLEGQLSELEQRLEKSQSEQDAFRSNLKTLLEILDGKIFELTELRDNLAKLLECS A6A21CB14207A384 home1_rat Homer protein homolog 1 Homer1 Homer Vesl PSD-Zip45 VASP/Ena-related gene up-regulated during seizure and LTP 1 protein protein rat Rattus norvegicus (Rat) Rat MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPAQNALPFSHSAGDRTQGLSHASSAISKHWEAELATLKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVTELECVSSQANAVHSHKTELSQTVQELEETLKVKEEEIERLKQEIDNARELQEQRDSLTQKLQEVEIRNKDLEGQLSELEQRLEKSQSEQDAFRSNLKTLLEILDGKIFELTELRDNLAKLLECS A6A21CB14207A384 pin1_human Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Rotamase Pin1 Peptidyl-prolyl cis-trans isomerase Pin1 PIN1 protein protein human Homo sapiens Human MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE DIP protein Q13526 original sequence version: 65 DIP protein Q13526 original sequence version: 64 DIP protein Q13526 original sequence version: 163 DIP protein Q13526 original sequence version: 156 DIP protein Q13526 original sequence version: 117 35391AF40B7D1E13 p31424-2 Metabotropic glutamate receptor 5 5a Grm5 Gprc1e Mglur5 protein protein rat Rattus norvegicus (Rat) Rat MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAVREQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISSEEEEGLVRCVDGSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGICIAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFLLLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNLRNPWFQEFWQHRFQCRLEGFAQENSKYNKTCNSSLTLRTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCPGYAGLCDAMKPIDGRKLLDSLMKTNFTGVSGDMILFDENGDSPGRYEIMNFKEMGKDYFDYINVGSWDNGELKMDDDEVWSKKNNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENEYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVIFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTSTVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLSSNGKSVTWAQNEKSTRGQHLWQRLSVHINKKENPNQTAVIKPFPKSTENRGPGAAAGGGSGPGVAGAGNAGCTATGGPEPPDAGPKALYDVAEAEESFPAAARPRSPSPISTLSHLAGSAGRTDDDAPSLHSETAARSSSSQGSLMEQISSVVTRFTANISELNSMMLSTAATPGPPGTPICSSYLIPKEIQLPTTMTTFAEIQPLPAIEVTGGAQGATGVSPAQETPTGAESAPGKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTLIIRDYTQSSSSL DIP protein P31424-2 original sequence version: 82 8B43A7D33497C3AC grm5_mouse Metabotropic glutamate receptor 5 Grm5 Gprc1e Mglur5 protein protein mouse Mus musculus Mouse MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAVREQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISSEEEEGLVRCVDGSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGICIAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFLLLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNLRNPWFQEFWQHRFQCRLEGFAQENSKYNKTCNSSLTLRTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCPGYAGLCDAMKPIDGRKLLDSLMKTNFTGVSGDMILFDENGDSPGRYEIMNFKEMGKDYFDYINVGSWDNGELKMDDDEVWSKKNNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENEYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVIFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTSTVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSMGNGGRATMSSSNGKSVTWAQNEKSTRGQHLWQRLSVHINKKENPNQTAVIKPFPKSTESRGQGAGAGGGSGPGAAGAGSAGCTATGGPEPPDAGPKALYDVAEAEERFPAAARPRSPSPISTLSHLAGSAGRTDDDAPSLHSETAARSSSSQGSLMEQISSVVTRFTANITELNSMMLSTAAAPGPPGTPICSSYLIPKEIQLPTTMTTFAEIQPLPAIEVTGGAQPATGPSPAQETPAGAEAAPGKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTLIIRDYTQSSSSL 2A09D7EC272ED23C q9z214-3 Homer protein homolog 1 Homer1 Homer Vesl PSD-Zip45 VASP/Ena-related gene up-regulated during seizure and LTP 1 1a Vesl protein protein rat Rattus norvegicus (Rat) Rat MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPAQNALPFSHRYTFNSAIMIK 9845DA6E2574BF83 grm5-pin1 4 7 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Fig. 1E, Supp. Fig. 1F Pin1 coimmunoprecipitation is increased in Homer1−/−Homer2−/−Homer3−/− mice Cocaine pin1-grm5 2 10 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1C pin1-grm5-1 2 10 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 inhibitor inhibitor unspecified role unspecified role physical association physical association Fig. 1C, 1D Homer1a concentration-dependently restores Pin1-mGluR5 binding in the presence of Homer1c pin1-grm5-2 3 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P31424-2:p.[Thr1123Ala;Ser1126Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A Wed May 02 16:23:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr1123ala,ser1126ala' Tue Jun 30 18:36:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr1123Ala;Ser1126Ala]' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association Supp. Fig. 1E pin1-grm5-3 3 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey Q3UVX5:p.[Thr1155Ala;Ser1158Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A Wed May 02 19:24:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr1155ala,ser1158ala' Tue Jun 30 16:13:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr1155Ala;Ser1158Ala]' physical association physical association Supp. Fig. 4F homer1-grm5-1 3 12 unspecified role unspecified role prey prey Q3UVX5:p.Phe1160Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F R Wed May 02 18:08:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe1160arg' Tue Jun 30 18:31:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe1160Arg' mouse-brain Mus musculus brain brain Brain [cerebrum] 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Supp. Fig. 4F grm5-homer1 1 12 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component ev1 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 46 48 direct interaction direct interaction Supp. Fig. 5A grm5-homer1-2 6 8 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role neutral component neutral component ser-1158 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 4C grm5-homer1-3 6 12 unspecified role unspecified role neutral component neutral component thr-1155 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ser-1158 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 4A Phosphorylation of the mGluR5 peptide at the Ser-1158 position increased the affinity of Homer1a by more than 10-fold, . Additional phosphorylation at the Thr-1155 site further increased Homer1a affinity. grm5-homer1-4 1 9 unspecified role unspecified role neutral component neutral component ev1 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 66 71 direct interaction direct interaction Fig. 4B, Supp. 5A Phosphorylation of either Ser-1158 site, or Thr-1155 and Ser-1158 sites together, does not drastically alter the free and Homer1 EVH1-bound equilibrium of the cis and trans isomers of mGluR5 at the Ser-1158-P bond grm5-homer1-6 1 8 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ev1 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role neutral component neutral component ser-1158 nphosres N-phosphorylated residue NPhosRes certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 13 competitor competitor competitor neutral component neutral component ecoli Escherichia coli (strain K12) 79 75 physical association physical association Fig. 4D grm5-pin1-1 5 10 enzyme enzyme unspecified role unspecified role 12 enzyme target enzyme target substrate substrate unspecified role unspecified role ser-1158 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined isomerase reaction isomerase reaction Fig. 5, Supp. Fig. 6 Q13526 increases activity of Q3UVX5